PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g43010.1.p
Common NameBRADI_4g43010, LOC104585198
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 338aa    MW: 37115.5 Da    PI: 4.2649
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g43010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM55.42.2e-17111405128
               NAM   5 frFhPtdeelvveyLkkkvegkkleleev.ikevdiy.kvePwdLpk....kvkaeek.ewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                       +rFh +  e v++yL + ++g++l+ +e  i+++diy ++e +dL +    + kae++ + +f +  ++++ + +r+ ra+ +g+W  + +  
  Bradi4g43010.1.p  11 CRFHLSPLEAVTYYLPRLLSGESLNGAERlIHRADIYgNLETKDLAAafppAPKAERTgDRFFLTLCKRQKGSRSRSARAAGAGTWTIQRT-L 102
                       69999******************7776656******9456*****7446763333444477999999999999*************98877.5 PP

               NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ev+++ g ++g  k L f kg +++ e+t Wvm+ey+ 
  Bradi4g43010.1.p 103 EVVDHAGVKKGEVKKLSFKKGIKKEKESTGWVMEEYHC 140
                       55566999*************99999**********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100520.1557160IPR003441NAC domain
PfamPF023655.2E-911139IPR003441NAC domain
SuperFamilySSF1019411.19E-1812159IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MELDMEVFQL CRFHLSPLEA VTYYLPRLLS GESLNGAERL IHRADIYGNL ETKDLAAAFP  60
PAPKAERTGD RFFLTLCKRQ KGSRSRSARA AGAGTWTIQR TLEVVDHAGV KKGEVKKLSF  120
KKGIKKEKES TGWVMEEYHC LLPEAVVADG EMVLCKIHLS PTACDEARQE SAAYLAGTQE  180
QEDQPARMPV TAKRPAPAAP DHDPPCAPKR ARVAAAEADH SQDIDAFRSP LEDLLADQPA  240
VEADDDNTGR LTCTMDELLG GATDEDQEDE ATALPAGETE QQTVDFDLDL PVLDEDALSE  300
VILSLDEDLP IASDEDFDFE FPTAEELNAM MVWRTGR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010239526.10.0PREDICTED: uncharacterized protein LOC104585198
TrEMBLI1IUI40.0I1IUI4_BRADI; Uncharacterized protein
STRINGBRADI4G43010.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9262314
MonocotsOGMP18322799