PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g41570.1.p
Common NameBRADI_4g41570, LOC104584776
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GATA
Protein Properties Length: 545aa    MW: 58935 Da    PI: 9.7883
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g41570.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA35.81.1e-11120153134
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                       C +C++ +Tp+ R+gp g  tLCnaCG+ y k+g
  Bradi4g41570.1.p 120 CLHCNAAETPQRRSGPMGRGTLCNACGVWYNKTG 153
                       99***************************99987 PP

2GATA321.7e-10262296135
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                       C nCg+++ p  R+gp g +++C aCG +y+k ++
  Bradi4g41570.1.p 262 CLNCGSSEPPELREGPMGRREVCTACGERYKKGRR 296
                       99******************************986 PP

3GATA50.33.2e-16359393135
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                       C +Cg+ kTp+WR+gp g  tLCnaCG++y+  +l
  Bradi4g41570.1.p 359 CMHCGSVKTPQWREGPMGRGTLCNACGVRYKQGRL 393
                       99*****************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577161.38E-10113157No hitNo description
SMARTSM004013.6E-8114172IPR000679Zinc finger, GATA-type
PROSITE profilePS501149.117114153IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.7E-10115153IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.11E-6119153No hitNo description
PfamPF003208.9E-9120153IPR000679Zinc finger, GATA-type
SMARTSM004018.3E-6256310IPR000679Zinc finger, GATA-type
PROSITE profilePS501148.708256292IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.09E-6259296No hitNo description
Gene3DG3DSA:3.30.50.101.2E-7260296IPR013088Zinc finger, NHR/GATA-type
PfamPF003201.0E-8262296IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.61E-14352414No hitNo description
SMARTSM004019.6E-14353403IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.756353389IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.2E-13357391IPR013088Zinc finger, NHR/GATA-type
CDDcd002028.72E-12358414No hitNo description
PfamPF003205.3E-14359393IPR000679Zinc finger, GATA-type
PROSITE patternPS003440359384IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0016021Cellular Componentintegral component of membrane
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 545 aa     Download sequence    Send to blast
MAGGGREAEG GGALYVLALA AMVAPALLVS RLEAAVPRRA RSRLPRAVPS GWWSSRISFF  60
PPPPPQPDQS EGQEKSPGPQ RPAAAAKDPP EKQKKRKSYP RPRPDPGAAG ERPAKRPKRC  120
LHCNAAETPQ RRSGPMGRGT LCNACGVWYN KTGALPELVP VDPPVESPIS EPEEPGAIYL  180
VRRSAAERRP PRTEAPAPRP AAVRRPPRAE ASPVPVPAPR PAAVRRPPRA EAPPVPVPAP  240
TPAADRRPPR TEAPAPRPAT SCLNCGSSEP PELREGPMGR REVCTACGER YKKGRRLPEC  300
QPAVRPVTDS PPHSPITANS PPDSPIWEPE APRSSVCLAR KSSKNGKTPW RPKDTGKSCM  360
HCGSVKTPQW REGPMGRGTL CNACGVRYKQ GRLLPEYRPM ASPTFLPSQH ANHHRQVLRL  420
HKQKPRSNDQ EPSQLPPGTN GVNQKWESKD QEPSQLPPAT HSVTKLTPIR DKHQTNMPDC  480
SYKEPVCDDH PTDMPGCTDE EPVEAPGCTH NPPIDVPRPS SLDSLLLDGP SAPLIVESDE  540
FAIS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1311GGREAEGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010238674.10.0PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 2
RefseqXP_010238675.10.0PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 2
TrEMBLI1IU160.0I1IU16_BRADI; Uncharacterized protein
STRINGBRADI4G41570.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
MonocotsOGMP72732646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.11e-28GATA transcription factor 9