PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g40948.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MIKC_MADS
Protein Properties Length: 157aa    MW: 17866.9 Da    PI: 10.0489
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g40948.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.72.4e-261058250
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                      rien   r vtf+kRr+g+lKKA ELSvLCdaev viifss+gkl+e +
  Bradi4g40948.2.p 10 RIENPAHRRVTFCKRREGLLKKARELSVLCDAEVGVIIFSSQGKLHELA 58
                      8*********************************************965 PP

2K-box33.22.2e-12791452086
             K-box  20 elakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkeke 86 
                       e+  +++ei  Lq+ +R   G + ++++l  L++Le+ Le+ + + Rs+K++++ ++i+ l +k  +
  Bradi4g40948.2.p  79 EILLVREEIGHLQHGLRSTYGGGAGDMTLDKLHKLEKGLEQWICHMRSTKMQIMQQEIQLLENKLLD 145
                       78889******************************************************99988655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.847161IPR002100Transcription factor, MADS-box
SMARTSM004323.6E-34160IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.92E-27172IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-26323IPR002100Transcription factor, MADS-box
CDDcd002651.18E-35373No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.3E-231056IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS512977.82773156IPR002487Transcription factor, K-box
PfamPF014862.0E-1279145IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MVRGKVRMRR IENPAHRRVT FCKRREGLLK KARELSVLCD AEVGVIIFSS QGKLHELATN  60
GNMQSLIGRY QSDVVAEPEI LLVREEIGHL QHGLRSTYGG GAGDMTLDKL HKLEKGLEQW  120
ICHMRSTKMQ IMQQEIQLLE NKLLDLAYQT LFGRVK*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi4g40948.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693281e-120KF469328.1 Brachypodium distachyon MADS-box transcription factor 34 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001289799.12e-93MADS-box transcription factor 33
SwissprotQ2QW551e-74MAD33_ORYSJ; MADS-box transcription factor 33
TrEMBLA0A2K2CTJ91e-110A0A2K2CTJ9_BRADI; Uncharacterized protein
STRINGBRADI4G40357.16e-93(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.18e-47AGAMOUS-like 12