PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g40357.1.p
Common NameBRADI_4g40357, LOC104584754
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MIKC_MADS
Protein Properties Length: 189aa    MW: 21330.6 Da    PI: 10.0437
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g40357.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.23.4e-261058250
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                      rien   r vtf+kRr+g+lKKA ELSvLCdaev viifss+gkl+e +
  Bradi4g40357.1.p 10 RIENPAHRRVTFCKRREGLLKKARELSVLCDAEVGVIIFSSQGKLHELA 58
                      8*********************************************965 PP

2K-box36.91.6e-13831631191
             K-box  11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeen 91 
                       + +++  + e+  +++ei  Lq+++R   G + ++++l  L++Le+ Le+ +++ Rs K++++ ++i+ l +k ke++e  
  Bradi4g40357.1.p  83 ALQSQVAEPEILLVREEIGHLQHSLRSTYGGGAGDMTLDKLHKLEKGLEQWISQMRSAKMQIMQQEIQLLENKVKEQNELM 163
                       455677788999*************************************************************99998865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.847161IPR002100Transcription factor, MADS-box
SMARTSM004323.6E-34160IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.06E-27175IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-26323IPR002100Transcription factor, MADS-box
CDDcd002651.34E-35373No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.9E-231056IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-263859IPR002100Transcription factor, MADS-box
PfamPF014861.3E-1285161IPR002487Transcription factor, K-box
PROSITE profilePS512978.89886176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MVRGKVRMRR IENPAHRRVT FCKRREGLLK KARELSVLCD AEVGVIIFSS QGKLHELATN  60
GNMQSLIGRY QSDVVGSQMQ NRALQSQVAE PEILLVREEI GHLQHSLRST YGGGAGDMTL  120
DKLHKLEKGL EQWISQMRSA KMQIMQQEIQ LLENKVKEQN ELMNMHSVFL GSPYSTHPFT  180
NGNGLFSI*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi4g40357.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693280.0KF469328.1 Brachypodium distachyon MADS-box transcription factor 34 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001289799.11e-137MADS-box transcription factor 33
SwissprotQ2QW552e-85MAD33_ORYSJ; MADS-box transcription factor 33
TrEMBLI1ITN11e-136I1ITN1_BRADI; MADS-box transcription factor 34
STRINGBRADI4G40357.11e-137(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.12e-50AGAMOUS-like 12
Publications ? help Back to Top
  1. Wei B, et al.
    Genome-wide analysis of the MADS-box gene family in Brachypodium distachyon.
    PLoS ONE, 2014. 9(1): p. e84781
    [PMID:24454749]