PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g34667.1.p
Common NameBRADI_4g34667, LOC100842906
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family SBP
Protein Properties Length: 422aa    MW: 44677.1 Da    PI: 7.5184
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g34667.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.56.1e-41106182278
                       -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
               SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                       C v+gC+adls++++yhrrhkvCe+hsk+pvv+v+g+e rfCqqCsrfh l efDe+krsCr+rL++hn+rrrk+q 
  Bradi4g34667.1.p 106 CAVDGCKADLSKCRDYHRRHKVCEAHSKTPVVVVAGREMRFCQQCSRFHLLAEFDEAKRSCRKRLDGHNRRRRKPQV 182
                       **************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.5E-3698167IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.342103180IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.08E-38104185IPR004333Transcription factor, SBP-box
PfamPF031103.3E-31106179IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MDWDLKMPVS WDLAELEHDA VPAMAAPAAV AAPGIAAAAP RGPECSVDLK LGGLGDFGAA  60
ADAMKETSAA KAPAVPSASA AAVVPSASPL KRPRPGGGGG GQCPSCAVDG CKADLSKCRD  120
YHRRHKVCEA HSKTPVVVVA GREMRFCQQC SRFHLLAEFD EAKRSCRKRL DGHNRRRRKP  180
QVESMSSGSF MTSQQGTRFA SFPVPRPEPS WSGMIKSEDS SPYYTHQVLN NNNRPHFAGS  240
TSTYSKEGRR FPFLHEGDQM SFSTGVEIPV CQPLLKSVVA PPPPESSSSN NNKMFSDGQL  300
THALDSDCAL SLLSSPGNSS SVDVSRMVRP TEHIPPVSQH LVPNLQFASS SWFACSQASS  360
GGGVSAAAGF AFPSMDSTQL NTAGLVPNSN DHEMNCHGIF HVGAEGSSDG TSPPLPFSWQ  420
Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-2796179184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19094KRPRP
2162179KRSCRKRLDGHNRRRRKP
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00555DAPTransfer from AT5G50570Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi4g34667.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0949131e-113FP094913.1 Phyllostachys edulis cDNA clone: bphyem212i14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003578390.10.0squamosa promoter-binding-like protein 18
SwissprotQ0J0K11e-155SPL18_ORYSJ; Squamosa promoter-binding-like protein 18
TrEMBLA0A0Q3HBU80.0A0A0Q3HBU8_BRADI; Uncharacterized protein
STRINGBRADI4G34667.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP17553795
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.18e-42SBP family protein