PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g34157.1.p
Common NameBRADI_4g34157, LOC100836586
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 355aa    MW: 39191.4 Da    PI: 9.6149
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g34157.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1775.3e-55271571128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdeelv++yL+ k+++ ++++ ++i+evd++k+ePwdLp+k+k +ekewyfFs rd+ky+tg r+nrat++gyWk+tgkdke++
  Bradi4g34157.1.p  27 LPPGFRFHPTDEELVTYYLRGKIADGSFTA-RAITEVDLNKCEPWDLPEKAKMGEKEWYFFSLRDRKYPTGVRTNRATNAGYWKTTGKDKEIF 118
                       79*************************999.89***************99999**************************************** PP

               NAM  94 sk....kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +     ++el g+kktLvfykgrap+gek++Wvmheyrl
  Bradi4g34157.1.p 119 TGqppsTQELAGMKKTLVFYKGRAPRGEKSNWVMHEYRL 157
                       9888888888***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-6324178IPR003441NAC domain
PROSITE profilePS5100560.12527178IPR003441NAC domain
PfamPF023651.5E-2828157IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MEGSGGGGGG LVSKKKQDDS KKKEESLPPG FRFHPTDEEL VTYYLRGKIA DGSFTARAIT  60
EVDLNKCEPW DLPEKAKMGE KEWYFFSLRD RKYPTGVRTN RATNAGYWKT TGKDKEIFTG  120
QPPSTQELAG MKKTLVFYKG RAPRGEKSNW VMHEYRLHSK PGSKSNKDEW VVCRIFAKTP  180
GVKKYPPNNA HTRPHHPYTL DMVPQLLPAL MQHDLFARGH HPYMTPADLV ELSRFARGTP  240
GLHPHIQPHP GYMNPSASFT LSNLNLNLGA PSPATGMPPQ HALHAMSMNQ TNATNQGYQV  300
TPAEHMAPGL GNYVIPPNGG DGGFGAGTTM GGTSIRYQNL DVDQLVEKCW PGSY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-542618416171NO APICAL MERISTEM PROTEIN
1ut4_B9e-542618416171NO APICAL MERISTEM PROTEIN
1ut7_A9e-542618416171NO APICAL MERISTEM PROTEIN
1ut7_B9e-542618416171NO APICAL MERISTEM PROTEIN
3swm_A1e-532618419174NAC domain-containing protein 19
3swm_B1e-532618419174NAC domain-containing protein 19
3swm_C1e-532618419174NAC domain-containing protein 19
3swm_D1e-532618419174NAC domain-containing protein 19
3swp_A1e-532618419174NAC domain-containing protein 19
3swp_B1e-532618419174NAC domain-containing protein 19
3swp_C1e-532618419174NAC domain-containing protein 19
3swp_D1e-532618419174NAC domain-containing protein 19
4dul_A9e-542618416171NAC domain-containing protein 19
4dul_B9e-542618416171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00277DAPTransfer from AT2G24430Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010238320.10.0PREDICTED: NAC domain-containing protein 92-like
TrEMBLI1IRF70.0I1IRF7_BRADI; Uncharacterized protein
STRINGBRADI4G34157.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP93613846
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.21e-89NAC domain containing protein 38