PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g33770.1.p
Common NameBRADI_4g33770, LOC100824643
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family SBP
Protein Properties Length: 408aa    MW: 42510.6 Da    PI: 7.9292
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g33770.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.73e-4277152176
                       --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
               SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                       +CqvegC +dls  k+y+ rhkvC++hskap v+v+g++qrfCqqCsrfh+l efD++krsCrrrLa+hnerrrk+
  Bradi4g33770.1.p  77 RCQVEGCGVDLSGDKTYYCRHKVCSMHSKAPLVVVAGIQQRFCQQCSRFHQLPEFDQGKRSCRRRLAGHNERRRKP 152
                       6*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.5E-3370139IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.96675152IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.92E-4076156IPR004333Transcription factor, SBP-box
PfamPF031102.8E-3378151IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048653Biological Processanther development
GO:2000025Biological Processregulation of leaf formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
METGSSGGGG GGGGDDFHGL KFGQKIYFEQ DVASGSGATT SAAGGGAGAG GEGAAAAASA  60
AAAAGNGAAH AQAQPPRCQV EGCGVDLSGD KTYYCRHKVC SMHSKAPLVV VAGIQQRFCQ  120
QCSRFHQLPE FDQGKRSCRR RLAGHNERRR KPPPGPLSSR YGRLAASFHE DPGRFRSFLL  180
DFSYPRVPSS VRDAWPTAHP GEHHRMPGTA AQWQGSHELH HPHRSTVAGY GVDHHAYAGQ  240
GSSSGGAAPM YPSFELPAAE CIAGVTAADS SCALSLLSTQ PWDHSAHSAS HNRPPAMSTA  300
SAFQVSPVAP SVMASDYMAA ASNSAWASTR GRNMQQHQQQ QHHHHHDAVM SDVHPGSVHQ  360
HGGQFGELEL ALQQGRAGAP NTPHAEHGSS GAGAFGHHSS NAMNWSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-29781511184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00307DAPTransfer from AT2G42200Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi4g33770.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003578329.10.0squamosa promoter-binding-like protein 17 isoform X1
SwissprotA3C0571e-142SPL17_ORYSJ; Squamosa promoter-binding-like protein 17
TrEMBLI1IR970.0I1IR97_BRADI; Uncharacterized protein
STRINGBRADI4G33770.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25273787
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.12e-45squamosa promoter binding protein-like 9