PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g33000.1.p
Common NameBRADI_4g33000, LOC100843805
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Dof
Protein Properties Length: 204aa    MW: 21835.1 Da    PI: 8.3569
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g33000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1161.5e-362886462
            zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                      +a +cprC+s++tkfCyynny+++qPr++C++CrryWtkGG+lrnvPvGg++r+n +ss
  Bradi4g33000.1.p 28 QAEACPRCESRDTKFCYYNNYNTTQPRHYCRSCRRYWTKGGSLRNVPVGGASRNNSSSS 86
                      6789**************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.3E-312984IPR003851Zinc finger, Dof-type
ProDomPD0074785.0E-212978IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.5873084IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103268IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MQEPGRRTAP PFAGVDLRRP KGYQALAQAE ACPRCESRDT KFCYYNNYNT TQPRHYCRSC  60
RRYWTKGGSL RNVPVGGASR NNSSSSSSSS SSPPKRTKNS SSNSKRRRVV PEPEHEPVRT  120
DASAPAATTE AVRPVTTEDA APDDPAVETE PSVKLGVGGG LADAGGKEPS PFEWPSGCDD  180
LAISYWGTGV LADADPAMFL NLP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1104108KRRRV
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence at the MNF1-binding site.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00672SELEXTransfer from GRMZM2G009406Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi4g33000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3541494e-72AK354149.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1005F20.
GenBankAK3609344e-72AK360934.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1128K17.
GenBankAK3770584e-72AK377058.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3146P05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576643.11e-148dof zinc finger protein MNB1A
SwissprotP385649e-45MNB1A_MAIZE; Dof zinc finger protein MNB1A
TrEMBLI1IR101e-146I1IR10_BRADI; Uncharacterized protein
STRINGBRADI4G33000.11e-147(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.15e-26Dof family protein
Publications ? help Back to Top
  1. Yanagisawa S,Izui K
    Molecular cloning of two DNA-binding proteins of maize that are structurally different but interact with the same sequence motif.
    J. Biol. Chem., 1993. 268(21): p. 16028-36
    [PMID:8340424]