PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g31690.1.p
Common NameBRADI_4g31690, LOC100822266
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HD-ZIP
Protein Properties Length: 337aa    MW: 35285.4 Da    PI: 5.7702
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g31690.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.22.8e-18175229256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Bradi4g31690.1.p 175 RKKLRLSKEQAAFLEESFKEHSTLNPKQKVALAKQLNLLPRQVEVWFQNRRARTK 229
                       788899***********************************************98 PP

2HD-ZIP_I/II126.11.5e-40175265192
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                       +kk+rlskeq+++LEesF+e+++L+p++Kv+la++L+l prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  Bradi4g31690.1.p 175 RKKLRLSKEQAAFLEESFKEHSTLNPKQKVALAKQLNLLPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELAELR-ALK 265
                       69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-17160225IPR009057Homeodomain-like
SuperFamilySSF466896.42E-18162232IPR009057Homeodomain-like
PROSITE profilePS5007117.006171231IPR001356Homeobox domain
SMARTSM003896.6E-16173235IPR001356Homeobox domain
PfamPF000461.6E-15175229IPR001356Homeobox domain
CDDcd000862.07E-16175232No hitNo description
PROSITE patternPS000270206229IPR017970Homeobox, conserved site
PfamPF021831.3E-10231265IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.4E-24231274IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MELGLSLGET MADAGRELVL GLGVGAGERR EEETGRGRRD QEVVAGARRD LGLGAMGCGS  60
SPEPTTMRLA LLPLVPSLGF PWPSESRHLE ASTPRGFDVN QAPSTGGSAW ACAAEEEEQE  120
DTAAVAGAAV SSSPNNSGGS FPMDFCAQGG DGAPGGGGGG GSRGGSDEDD GGSSRKKLRL  180
SKEQAAFLEE SFKEHSTLNP KQKVALAKQL NLLPRQVEVW FQNRRARTKL KQTEVDCEYL  240
KRCCETLTEE NRRLQKELAE LRALKTVHPF YMHLPATTLS MCPSCERVAS NSAPASAAAG  300
GIAAAAPEHR PPSSFAALFS SARSFTQAPA PAPSSS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1173179SRKKLRL
2223231RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi4g31690.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0364471e-152BT036447.1 Zea mays full-length cDNA clone ZM_BFb0114O05 mRNA, complete cds.
GenBankKJ7269111e-152KJ726911.1 Zea mays clone pUT3456 HB transcription factor (HB11) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576587.10.0homeobox-leucine zipper protein HOX11
SwissprotQ67UE21e-133HOX11_ORYSJ; Homeobox-leucine zipper protein HOX11
TrEMBLA0A0Q3HAK00.0A0A0Q3HAK0_BRADI; Uncharacterized protein
STRINGBRADI4G31690.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52093363
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.18e-69homeobox from Arabidopsis thaliana