PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g29700.2.p
Common NameBRADI_4g29700, LOC100842585
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 457aa    MW: 46933.9 Da    PI: 7.4853
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g29700.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.5e-32263316255
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Bradi4g29700.2.p 263 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 316
                       9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.51E-15260317IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-28261317IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-23263316IPR006447Myb domain, plants
PfamPF002498.5E-7264315IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 457 aa     Download sequence    Send to blast
MEASSPDLSL HISLPSSGPP TGPVDGLGPR AGGGDPWRRL NGSTASTELS LSPPLLQEGA  60
ASLPWPRQRA PSSAAAPSSS AAATTSAALM TMPMLLHPLD AAAGAANGAS ASPPIRGIPI  120
YNGAGAGFPF LPPAAQGGGG LELPKVGFYS GSYHQNHHPA TTWPSSLGAT SPSANSTFDP  180
AAATAFGLSP AAHHRMLQSA SGRLNGMLSD TLRGYGGSPG GIGIGMGGHQ YHHLHGHGHG  240
AQHGGPFGRF MPKLPAKRSM RAPRMRWTST LHARFVHAVE LLGGHERATP KSVLELMDVK  300
DLTLAHVKSH LQMYRTVKST DKPAASSGPA DGGSGDEDFP SAGQAGSGGD NNMCPRPFPE  360
HRSTSEGAAS SVGGGDMDQS SAGNASTRWS NSSRDPWLSS NSCNMDAHRS VGLSSPIENM  420
EACRSSGSQV SNHELSSPSL EFTLGRPDWH GVDHDH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-16264318357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-16264318357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-16264318357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-16264318357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi4g29700.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3771030.0AK377103.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3148F08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576503.10.0probable transcription factor RL9
SwissprotQ0J2351e-149ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A0Q3H9X00.0A0A0Q3H9X0_BRADI; Uncharacterized protein
STRINGBRADI4G29700.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Representative plantOGRP5701580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.16e-57G2-like family protein