PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g27620.2.p
Common NameBRADI_4g27620, LOC100838837
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 282aa    MW: 30540.6 Da    PI: 6.4253
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g27620.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.92e-322377155
           G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      ++rlrWt eLHe+Fveav+qLGG+++AtPk +l++m+ +gLt++hvkSHLQkYRl
  Bradi4g27620.2.p 23 RQRLRWTDELHEQFVEAVTQLGGPDRATPKGVLRIMGTPGLTIYHVKSHLQKYRL 77
                      58****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.8142080IPR017930Myb domain
SuperFamilySSF466891.97E-172277IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.3E-312278IPR009057Homeodomain-like
TIGRFAMsTIGR015579.1E-252478IPR006447Myb domain, plants
PfamPF002493.9E-92576IPR001005SANT/Myb domain
PfamPF143792.7E-23110155IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MELGGNNMGS NDGANSKASL AARQRLRWTD ELHEQFVEAV TQLGGPDRAT PKGVLRIMGT  60
PGLTIYHVKS HLQKYRLAKY IPDSSTDGNK SDNKDPGDSL AGLDGSSGLQ ISEALKLQME  120
VQKRLHEQLE VQRQLQLRIE AQGKYLKKII EEQQRYGGIK SETPGAGGTA TVSSDQFPDS  180
ERTDPSTPAP TSESSQGVPF KRDNGGQTEA TKSPCHDEQL TTDSNCHPGS PTVSPKHERA  240
AKRQRGNGTE FSEADLSLPQ HIFESSSGPE FQQCSVPYSG H*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-232380158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-232380158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-232380158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-232380158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00252DAPTransfer from AT2G01060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi4g27620.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3657330.0AK365733.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2037A13.
GenBankAK3738550.0AK373855.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3045J14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003577958.10.0myb family transcription factor PHL7
RefseqXP_010238039.10.0myb family transcription factor PHL7
SwissprotQ9SJW01e-91PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLI1IP840.0I1IP84_BRADI; Uncharacterized protein
STRINGBRADI4G27620.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.12e-68G2-like family protein