PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g26802.1.p
Common NameBRADI_4g26802, LOC100821445
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 372aa    MW: 41084.6 Da    PI: 7.9432
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g26802.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.21.2e-3077130255
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       prlrWtpeLH++F++ave+LGG+++AtPk +l+lm+v gL++ hvkSHLQ+YR+
  Bradi4g26802.1.p  77 PRLRWTPELHHCFLRAVERLGGQDHATPKLVLQLMNVRGLSIGHVKSHLQMYRS 130
                       9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-2973131IPR009057Homeodomain-like
PROSITE profilePS5129412.9773133IPR017930Myb domain
SuperFamilySSF466891.49E-1574131IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-2376132IPR006447Myb domain, plants
PfamPF002492.0E-978129IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MHQDQTSSSI SSPHQLHLAR DPSHISHMAG EIGKVMGNDH GSSEEGSNDD DSTVEEEDHR  60
KTNGDSSVRP YVRSKNPRLR WTPELHHCFL RAVERLGGQD HATPKLVLQL MNVRGLSIGH  120
VKSHLQMYRS KKIEDSGQVI LGGHLQQGGQ TYNVAHHVPY HHRQSTSAGT MLSKFGTAAP  180
WRMSNHEPFW LPGHRFLGSR PYYYPSSLSS SPSSHHAEAL LRTRAHEHVA RSGISASMMI  240
TQGSCSSVND QYHERKLQAA MSTTVRISDD RSSHGADLDL SLSLDIGGTR REMKRRRGCI  300
SWGKEDDDQM GDGNEEKLDQ STANMLSLSL VSPSSATSDQ HMPGLEVIGV GKRGNKERNI  360
GRKESSLDLT I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A7e-1678132357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-1678132357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-1678132357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-1678132357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi4g26802.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003577903.20.0two-component response regulator ARR14 isoform X1
TrEMBLA0A0Q3HN970.0A0A0Q3HN97_BRADI; Uncharacterized protein
STRINGTRIUR3_10881-P11e-106(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44083671
Representative plantOGRP28515123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.12e-37G2-like family protein