PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g26170.1.p
Common NameBRADI_4g26170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family ZF-HD
Protein Properties Length: 105aa    MW: 10915.4 Da    PI: 6.8911
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g26170.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer84.89.6e-272579359
       ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                       v Y +C++NhA ++G havDGCgEfm+s+ +   +aal+CaACgCHR++H re  +
  Bradi4g26170.1.p 25 VVCYTKCMRNHALAVGKHAVDGCGEFMASSPD--PTAALTCAACGCHRSYHLREIIY 79
                      689*************************9444..589**************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047702.5E-242677IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152323.572876IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257741.0E-132880IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.2E-212877IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 105 aa     Download sequence    Send to blast
MSSSSSFQQQ NGPASAQLSG VVTPVVCYTK CMRNHALAVG KHAVDGCGEF MASSPDPTAA  60
LTCAACGCHR SYHLREIIYE FSVLPPPPAV IDGQSPMNSA KTEN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi4g26170.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001310997.16e-21zinc finger homeodomain protein 1
TrEMBLI1INP42e-71I1INP4_BRADI; Uncharacterized protein
STRINGBRADI4G26170.14e-72(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69600.13e-20zinc finger homeodomain 1