PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g26093.1.p
Common NameBRADI_4g26093
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family ZF-HD
Protein Properties Length: 97aa    MW: 10393.9 Da    PI: 6.8905
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g26093.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer80.71.8e-252580360
       ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                       v Y +C++NhA   G h vDGCgEfm+s g++  +aal+CaACgCHRn+H re ++e
  Bradi4g26093.1.p 25 VVCYTKCMRNHASPFGRHNVDGCGEFMAS-GSD-PMAALTCAACGCHRNYHLREITYE 80
                      689*************************9.554.79*****************98775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257749.0E-131480IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.7E-232677IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152321.832876IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.4E-202877IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 97 aa     Download sequence    Send to blast
MSSSFLPEQQ NGPASAQLNG LVTPVVCYTK CMRNHASPFG RHNVDGCGEF MASGSDPMAA  60
LTCAACGCHR NYHLREITYE FYVLPPLPTV ISLLNS*
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269|PubMed:21455630}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi4g26093.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012469414.11e-19PREDICTED: zinc-finger homeodomain protein 6-like
SwissprotQ2Q4934e-17MIF3_ARATH; Mini zinc finger protein 3
TrEMBLA0A0Q3EPZ91e-65A0A0Q3EPZ9_BRADI; Uncharacterized protein
STRINGBRADI4G26170.17e-45(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18835.12e-19mini zinc finger