PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g22681.1.p
Common NameBRADI_4g22681
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 192aa    MW: 21770.5 Da    PI: 9.5786
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g22681.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM111.11.3e-34171381128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lp Gf+F+P+d++l+ eyL ++  +++l+   vi e+di+ + PwdL     ++ ke yf ++rd ky  g+r nr+t++gyWka  ++ +++
  Bradi4g22681.1.p  17 LPSGFKFRPSDKDLILEYLYRRSIDEPLPW-AVIVEADIMGSSPWDLL---PEGAKEKYFLTRRDLKYMDGSRINRITQEGYWKARRTESPIY 105
                       699**************************9.89**************4...457899************************************ PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       + ++ lvg++++L fy   +pkg +t W m eyrl
  Bradi4g22681.1.p 106 V-HNILVGMRRSLLFY-VGTPKGMRTIWAMREYRL 138
                       *.999***********.678999**********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.01E-3614144IPR003441NAC domain
PROSITE profilePS5100536.35917166IPR003441NAC domain
PfamPF023654.1E-1718138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MAANVPVPMA DGSVLMLPSG FKFRPSDKDL ILEYLYRRSI DEPLPWAVIV EADIMGSSPW  60
DLLPEGAKEK YFLTRRDLKY MDGSRINRIT QEGYWKARRT ESPIYVHNIL VGMRRSLLFY  120
VGTPKGMRTI WAMREYRLAG AGLSPCMVMR PTGSETFGRT CQIDATATAK RCRRGEVELD  180
NMILQVPFVI V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-301513813140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010237849.11e-124PREDICTED: NAC domain-containing protein 83-like
TrEMBLA0A0Q3HL811e-140A0A0Q3HL81_BRADI; Uncharacterized protein
STRINGBRADI4G22680.11e-117(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP44822369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33480.23e-35NAC domain containing protein 41