PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g18891.1.p
Common NameBRADI_4g18891
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family SBP
Protein Properties Length: 397aa    MW: 42421.6 Da    PI: 8.9226
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g18891.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.65.4e-41140216278
                       -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
               SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                       C v+gC++dls+++eyhrrhkvCe+hsk+pvv+v+g+e+rfCqqCsrfh+l efDe+krsCr+rL++hn+rrrk+q 
  Bradi4g18891.1.p 140 CSVDGCRSDLSRCREYHRRHKVCEAHSKTPVVVVAGQEKRFCQQCSRFHMLAEFDEGKRSCRKRLDGHNRRRRKPQY 216
                       **************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.5E-33135201IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.094137214IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.71E-39138219IPR004333Transcription factor, SBP-box
PfamPF031104.1E-30140213IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MPHGHTPSST ERYCHTSSDP CPELHTRTLC APSRPARASA RHCAAAVVAP RRLPPTSGGS  60
RRIVRFFLAR MDWAAAPEAA SWGVAAEAVA DPGPTMLSFA SPSFSSSAAV AAQLQDRSRP  120
ASVTARRDRA PGSAAGTVAC SVDGCRSDLS RCREYHRRHK VCEAHSKTPV VVVAGQEKRF  180
CQQCSRFHML AEFDEGKRSC RKRLDGHNRR RRKPQYDAMN PSSFFPYHQV NKFSVYPRTF  240
PIADPNAGAS MHPLEHHRPF SISFSGTTKA PKHFPFLQDG SSIYSTASPT LPQPFSSRED  300
GNNTSSSTCN GLSSALDPEC ALSLLSSSLH LSPISIPSAT VPAQFASSLA RTAVDSQAAT  360
IAFASGGDCG GGGGHVLVAD AMLEDPSQGL PFCWQV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-27134213584squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1196213KRSCRKRLDGHNRRRRKP
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi4g18891.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003577554.20.0putative squamosa promoter-binding-like protein 19
SwissprotQ2R3Y11e-116SPL19_ORYSJ; Putative squamosa promoter-binding-like protein 19
TrEMBLA0A0Q3ELQ90.0A0A0Q3ELQ9_BRADI; Uncharacterized protein
STRINGBRADI4G18900.11e-153(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129612532
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.14e-43SBP family protein