PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g12065.1.p
Common NameBRADI_4g12065
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 295aa    MW: 32582.3 Da    PI: 5.5926
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g12065.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.72.3e-4911281128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGf+FhPtd+el+ +yL++++++ ++++  +i++vdiyk++PwdLp ++ ++e+ewyfFs+rd+ky++  r+nra+ sgyWkatgkdk+++
  Bradi4g12065.1.p   1 LPPGFQFHPTDDELILHYLRNRAASVPCPV-PIIADVDIYKFDPWDLPCQAVHGEQEWYFFSPRDRKYPNWIRPNRAAGSGYWKATGKDKPIH 92 
                       79****************************.88***************76667899************************************9 PP

               NAM  94 sk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +  +ge vg+kk Lvfy+gr p g++tdW+mheyrl
  Bradi4g12065.1.p  93 DCaTGEPVGIKKGLVFYTGRPPMGRRTDWIMHEYRL 128
                       9778999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100556.7581166IPR003441NAC domain
SuperFamilySSF1019418.5E-601165IPR003441NAC domain
PfamPF023658.6E-262128IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
LPPGFQFHPT DDELILHYLR NRAASVPCPV PIIADVDIYK FDPWDLPCQA VHGEQEWYFF  60
SPRDRKYPNW IRPNRAAGSG YWKATGKDKP IHDCATGEPV GIKKGLVFYT GRPPMGRRTD  120
WIMHEYRLAV SSDGPITSNN NNNNNNNNNN NNNNLDDWVL CRISMSSSSP ALPVVVVPSP  180
AADDHMDNSN IKDDDGLLRF FVDPGAPGLP GPAVPSMSEL LDNDELTQLL DAAAPADEHL  240
SLNQLLSIGD CHDARAEYSS SPPPAPINAG KRKAACPEED RRAIFRRGKA SYRN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-62116315165Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family associated with the grain protein content (GPC). Sequences of the 11 European varieties of H.vulgare tested belongs to the same haplotype while the sequence found in H.spontaneum, an ancestor of the cultivated H.vulgare which has a higher GPC, belongs to an other haplotype. {ECO:0000269|PubMed:20005003}.
UniProtTranscription factor of the NAC family. May be associated with anther development and pollen production (Probable). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305|PubMed:21107887}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi4g12065.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024310305.10.0NAC domain-containing protein 67-like
SwissprotD2SMN41e-70NAMB1_HORVS; NAC transcription factor NAM-B1
SwissprotQ8GY421e-71NAC25_ARATH; NAC transcription factor 25
TrEMBLA0A0Q3EIK30.0A0A0Q3EIK3_BRADI; Uncharacterized protein (Fragment)
STRINGBRADI1G17480.11e-107(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123736123
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.16e-72NAC domain containing protein 25
Publications ? help Back to Top
  1. Jamar C, et al.
    NAM-1gene polymorphism and grain protein content in Hordeum.
    J. Plant Physiol., 2010. 167(6): p. 497-501
    [PMID:20005003]