PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g11101.1.p
Common NameLOC100834843
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 111aa    MW: 12482.7 Da    PI: 10.5571
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g11101.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF66.72.2e-211053245
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                      + en s r+vt+skRr gilKKA+ELS+LCd++  +++fs++g+
  Bradi4g11101.1.p 10 KLENISGRHVTYSKRRSGILKKAKELSILCDIDLILLMFSPSGR 53
                      67999************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.829153IPR002100Transcription factor, MADS-box
SMARTSM004321.8E-27160IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.58E-25295IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-17323IPR002100Transcription factor, MADS-box
PfamPF003199.2E-191154IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 111 aa     Download sequence    Send to blast
MGRVKLKIKK LENISGRHVT YSKRRSGILK KAKELSILCD IDLILLMFSP SGRPTICVGD  60
RSNLEEVIAK YAQQTPQERA KRKLESLEAL KKTFKKLDHD VNIQDFLGSG *
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi4g11101.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693370.0KF469337.1 Brachypodium distachyon MADS-box transcription factor 43 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288313.12e-70MADS-box transcription factor 7-like
SwissprotQ7X9I05e-52AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLA0A2K2CM201e-73A0A2K2CM20_BRADI; Uncharacterized protein
STRINGBRADI4G11097.16e-70(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Representative plantOGRP59461119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.13e-43AGAMOUS-like 65
Publications ? help Back to Top
  1. Wei B, et al.
    Genome-wide analysis of the MADS-box gene family in Brachypodium distachyon.
    PLoS ONE, 2014. 9(1): p. e84781
    [PMID:24454749]
  2. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]