PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g09239.1.p
Common NameBRADI_4g09239
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 608aa    MW: 69031 Da    PI: 7.7416
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g09239.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS319.47.3e-982255962373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                        +lL++cAeav+s+dl+ a+++L++++  +sp+gd+ qRla yf ++L++rla+++s+ y++l  +++s   ++e ++a++l+  ++ +lk++
  Bradi4g09239.1.p 225 DTLLIRCAEAVASNDLRSASEVLEQIKRYSSPTGDARQRLAYYFSQGLESRLAGTGSQFYRSLIRTRAS---TVELVKAYHLYDATFCFLKVA 314
                       679**********************************************************99666666...799****************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                       +l  N++I++av+g +++Hi+ ++i+ GlQWp L+q L +R++gpp +R+T ++ p++g    e++ee g+rL+++A+++gv+++f++ +a +
  Bradi4g09239.1.p 315 FLFSNKTIYKAVAGRKKLHIVHYGINLGLQWPDLIQWLVDREDGPPVVRMTSINMPQPGfsPYEQIEEAGHRLSNYASKFGVSIKFQA-IAGT 406
                       **********************************************************99999*************************.799* PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                        e+++ e+L+++p+E+l+Vn+ +q ++ +des++ +s  +rd vL ++++++P v+v++  + +++++ +++rf +al+ ++alf+++e+ +p
  Bradi4g09239.1.p 407 PEAVRAEDLHIDPDEVLVVNSLFQFKTWMDESLKFDSvsPRDMVLATIRRMKPPVFVHAVINGSYSAAFLMTRFRQALYSFTALFNMMETMVP 499
                       *********************************999988****************************************************** PP

              GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                       r++++r  vEr +++r++ n++acega+r+er + +++W++r ++aG++++pl+++++   k  +++ + +  +++ee+ +l++gWk+r L++
  Bradi4g09239.1.p 500 RDNKQRLQVERDFFARSAINMIACEGADRVERPQYYKEWQMRNHRAGLRQLPLDSDIVLMLKDKVKNQNHRHLMINEEHRWLLQGWKGRVLYA 592
                       *********************************************************************999********************* PP

              GRAS 370 vSaW 373
                       +S W
  Bradi4g09239.1.p 593 LSTW 596
                       **** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.846198577IPR005202Transcription factor GRAS
PfamPF035142.5E-95225596IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 608 aa     Download sequence    Send to blast
MVTQPQEDLA LEHISRMLME DDIVDKFTYQ YPDHPKLLQA EQPFAQILSA AATSSFDAKE  60
LSAPDALASA LLPSKVQDPA FFSSGTVELS STVFPIESST GMNILNNMSS MAFFKGMEEA  120
KMFLPRNNVM VDSRGCENKF QIDGEREPAM GRGSKQIAAP VHTDSEEEDE LKKRLDRLIL  180
KGYDRYPGEM QEVLITSDKE NKAARKSIRM RGRHGAMQAV VTHLDTLLIR CAEAVASNDL  240
RSASEVLEQI KRYSSPTGDA RQRLAYYFSQ GLESRLAGTG SQFYRSLIRT RASTVELVKA  300
YHLYDATFCF LKVAFLFSNK TIYKAVAGRK KLHIVHYGIN LGLQWPDLIQ WLVDREDGPP  360
VVRMTSINMP QPGFSPYEQI EEAGHRLSNY ASKFGVSIKF QAIAGTPEAV RAEDLHIDPD  420
EVLVVNSLFQ FKTWMDESLK FDSVSPRDMV LATIRRMKPP VFVHAVINGS YSAAFLMTRF  480
RQALYSFTAL FNMMETMVPR DNKQRLQVER DFFARSAINM IACEGADRVE RPQYYKEWQM  540
RNHRAGLRQL PLDSDIVLML KDKVKNQNHR HLMINEEHRW LLQGWKGRVL YALSTWVAND  600
ASSSEVT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-382285968374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010238972.10.0PREDICTED: scarecrow-like protein 14
TrEMBLA0A0Q3HFE30.0A0A0Q3HFE3_BRADI; Uncharacterized protein
STRINGBRADI4G09235.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-120SCARECROW-like 14