PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g09238.1.p
Common NameBRADI_4g09238
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 631aa    MW: 71685.7 Da    PI: 7.1227
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g09238.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS330.43.3e-1012486192373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       + lL++cAeav+s+d + a++lL+r++ ++sp+g++ qRla+yf++AL+ar+a+++ + y+ l   +ts   ++e ++a++l+s ++ + k++
  Bradi4g09238.1.p 248 EMLLIRCAEAVASNDRSSASELLERIKWHSSPRGNARQRLAHYFAQALEARVAGTGRQFYQPLIGMRTS---TVEYIKAYHLYSATFCFGKVA 337
                       579**********************************************************99877777...89******************* PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                       +l  N++I++a++g +++Hi+ ++i+ GlQWp L+q La+R++gpp++R+T +++p++g   +e++ee g+rL+++A ++gv+++f++ ++ +
  Bradi4g09238.1.p 338 FLFSNKTIYNAIAGRRKLHIVHYGINTGLQWPDLIQWLADREGGPPEVRMTSIDRPQPGfrPSEQIEEAGHRLTNYAIKFGVSIKFHA-ITAE 429
                       ****************************************************************************************.6889 PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                        e+++ e+L+++p+E+l+Vn+ +q  +l+des++ +   +rd+vL+++++++P v+++  ++ +++s+ F +rf +al+ ++alfd +e+++p
  Bradi4g09238.1.p 430 PEAVRAEDLHIDPDEVLVVNSLFQFRNLMDESLAFDRvsPRDKVLNTIRKMKPSVFIHGISNGSYGSAVFRTRFRHALHNFTALFDVMETTIP 522
                       9*******************************9988777****************************************************** PP

              GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                       r++++r  +Er +++r+++n++acega+r+er +++++W++r ++aG++++pl+ +++   k  +r+ + + ++++e+++ l++gWk+r+L++
  Bradi4g09238.1.p 523 RNNDKRLQLERDFFARSAMNMIACEGADRVERPQNYREWQMRNHRAGLRQLPLDPDVVLMLKEEVRNKYHKHFMINEHHQLLLQGWKGRALYA 615
                       *********************************************************************999********************* PP

              GRAS 370 vSaW 373
                        S W
  Bradi4g09238.1.p 616 HSTW 619
                       **** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.358221600IPR005202Transcription factor GRAS
PfamPF035141.2E-98248619IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 631 aa     Download sequence    Send to blast
MAVTQEDQLL GVVESAPLPR SVSLDLPQTT HGDSKQPQDD LSLAYISRML MEDDIVDKFV  60
CQYPDQPKLL QAEQHFARIL STAATTSYEA QESSAPDALA SALLPSEVHD PAFFSSGTVE  120
LSSTLFPVEC STSMNKMSHM AFFKGIEEGK MFLPRDNLMV DSRGCMNKFD MGGVTEPAMG  180
RSSKRIAVLV QTDPEEDDML KKMLDRLILN GYDRYPSEMQ DLIITLDKEN IRRHRRRGAR  240
QMVVTDLEML LIRCAEAVAS NDRSSASELL ERIKWHSSPR GNARQRLAHY FAQALEARVA  300
GTGRQFYQPL IGMRTSTVEY IKAYHLYSAT FCFGKVAFLF SNKTIYNAIA GRRKLHIVHY  360
GINTGLQWPD LIQWLADREG GPPEVRMTSI DRPQPGFRPS EQIEEAGHRL TNYAIKFGVS  420
IKFHAITAEP EAVRAEDLHI DPDEVLVVNS LFQFRNLMDE SLAFDRVSPR DKVLNTIRKM  480
KPSVFIHGIS NGSYGSAVFR TRFRHALHNF TALFDVMETT IPRNNDKRLQ LERDFFARSA  540
MNMIACEGAD RVERPQNYRE WQMRNHRAGL RQLPLDPDVV LMLKEEVRNK YHKHFMINEH  600
HQLLLQGWKG RALYAHSTWA ADDAGGSDLT *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-402516198374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575626.20.0PREDICTED: scarecrow-like protein 33
TrEMBLA0A0Q3H1290.0A0A0Q3H129_BRADI; Uncharacterized protein
STRINGBRADI4G09235.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-122GRAS family protein