PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g09237.1.p
Common NameBRADI_4g09237
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 586aa    MW: 66481.7 Da    PI: 8.6212
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g09237.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS328.81.1e-1002035742373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       ++lL++cAeav+ +d + a+++L+r++  +s +gd+ qRla+y++++L+arla+++s+ y++l  ++ts   + e ++a++l++ ++ ++k++
  Bradi4g09237.1.p 203 ETLLIRCAEAVARHDRRSASEVLERIKRYSSLTGDARQRLAHYLAQGLEARLAGTGSQFYRSLIGTRTS---TMELVKAYHLYNTTFCFFKVA 292
                       789***********************************************************9888887...799999*************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                       ++  N++I++av+g +++Hi+ ++ + GlQWp L++ La+R++gpp++R+T +++pe+g   +e++eetg+rL+++A+++gv+++f++ ++ +
  Bradi4g09237.1.p 293 FFFSNKTIYKAVAGRKKLHIVHYGSNIGLQWPDLIRWLADREGGPPEVRMTSINRPEPGfrPSEQIEETGDRLRNYASKFGVSINFHA-ITAQ 384
                       **********************************************************9*****************************.6889 PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                        e+++ e+++++p+E+l+Vn+ +q ++l+des++ +   +rd vL+++++++P v+v++ ++ +++++ F++rf +al+ ++a+fd +e+ +p
  Bradi4g09237.1.p 385 PEAVRAEDIHIDPDEVLVVNSLFQFKTLMDESLTFDRvsPRDMVLNTIRKMKPSVFVHAVSNGSYSAALFMTRFRHALYNFTAFFDVMETMIP 477
                       ********************************9988777****************************************************** PP

              GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                       r++++r  vErel++r++ n+vacega+r+er +++++W++r ++aG++++pl+ +++   k  +++ + + ++++e++ +l++gWk+r L++
  Bradi4g09237.1.p 478 RNNDKRLQVERELFARSVINIVACEGADRVERPQNYREWQARHHRAGLRQLPLDPDIVLMLKDKVKNDYHKHFMINEDHRWLLQGWKGRVLYA 570
                       *******************************************************************99999********************* PP

              GRAS 370 vSaW 373
                       +S W
  Bradi4g09237.1.p 571 LSTW 574
                       **** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.158176555IPR005202Transcription factor GRAS
PfamPF035143.7E-98203574IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 586 aa     Download sequence    Send to blast
MEDDIIDTFS YQYPDHPKLL QAEQPFAKIL SAAASTTFNA EESSAPDALT TALLPSKVQD  60
PAFSSNGTGT VEPAFPVKSS TGMNKMSSMT FFEGMAENKM FLPRDNVMVQ SRGCKNKFDM  120
KGDTEPGIGR SSKQIAVLVH TDSEEEVELK KRLDRLILDG YDRYPGEMQE VLISLDKENK  180
VAQKSSRMCG RRGVTQTVGT DLETLLIRCA EAVARHDRRS ASEVLERIKR YSSLTGDARQ  240
RLAHYLAQGL EARLAGTGSQ FYRSLIGTRT STMELVKAYH LYNTTFCFFK VAFFFSNKTI  300
YKAVAGRKKL HIVHYGSNIG LQWPDLIRWL ADREGGPPEV RMTSINRPEP GFRPSEQIEE  360
TGDRLRNYAS KFGVSINFHA ITAQPEAVRA EDIHIDPDEV LVVNSLFQFK TLMDESLTFD  420
RVSPRDMVLN TIRKMKPSVF VHAVSNGSYS AALFMTRFRH ALYNFTAFFD VMETMIPRNN  480
DKRLQVEREL FARSVINIVA CEGADRVERP QNYREWQARH HRAGLRQLPL DPDIVLMLKD  540
KVKNDYHKHF MINEDHRWLL QGWKGRVLYA LSTWVADDAS SSNVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-412065748374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575625.30.0PREDICTED: scarecrow-like protein 14
TrEMBLA0A0Q3EH360.0A0A0Q3EH36_BRADI; Uncharacterized protein
STRINGBRADI4G09155.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-124SCARECROW-like 14