PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g09235.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 501aa    MW: 57227 Da    PI: 9.5745
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g09235.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS336.26e-1031184892373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       ++lL++cAea++s+d + a++lL+r++  +sp+gd+ qRla+yf+++L+arl++++s+ly+++  ++ts    +e ++a++l++ ++ ++k++
  Bradi4g09235.2.p 118 ETLLIRCAEAMTSNDRRSASELLERIKRYSSPTGDARQRLAHYFAQGLEARLVGTGSQLYRSCMGRRTS---IVELIKAYHLYNATCCFVKMA 207
                       789**********************************************************99999998...9******************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                        l  N++I++av+g +++Hi+ ++i+ GlQWp L++ La+R++gpp++RiTg++ p++g   +e+++etg+rL+++A+++gv+f+f++ +  +
  Bradi4g09235.2.p 208 MLFSNKTIYNAVAGRRKLHIVHYGINSGLQWPKLIRWLAEREGGPPEIRITGINMPQPGfnLAEQIKETGQRLSNYASKFGVSFKFHA-IIAK 299
                       **********************************************************99999*************************.6999 PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                       le+++ e+L+++p+E+l+Vn+ +q   l+des+s ++  +rd vL+ +++++P ++++   + +h+++ F++rf +al++++alfd++e+ + 
  Bradi4g09235.2.p 300 LEAVHAEDLHIDPDEVLIVNSLFQFRILMDESLSFDNvsPRDMVLNNIRKMKPSMFIHGIANGSHSAAFFMTRFRQALSHFTALFDMMETIMQ 392
                       **********************************99988*****************************************************9 PP

              GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                        + ++r  vEr+++++ + n++aceg +r+er +++++W+ r ++aG++++pl+++++   k  +++ + + ++++e++ ++++gWk+r L++
  Bradi4g09235.2.p 393 GNYDKRLRVERAIFAWCAINMIACEGVDRVERPQNYREWQVRKNRAGLRQLPLDSDTVLMLKNEVKNQYHKHFMIDEDHRWVLQGWKGRVLYA 485
                       999******************************************************************999********************* PP

              GRAS 370 vSaW 373
                       +S W
  Bradi4g09235.2.p 486 LSTW 489
                       **** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.71691470IPR005202Transcription factor GRAS
PfamPF035142.1E-100118489IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    Send to blast
MDMLSSMAFY KGMEEANMFL PRCNRMVDGR GRKNRFDMDG EMEGGMGRSS KQIVLVHTDS  60
AEETTALKKL DRLVLYGSDT CSGEMQEILI NKEKMAAEKS IRRRGRGSAR QMVVTDLETL  120
LIRCAEAMTS NDRRSASELL ERIKRYSSPT GDARQRLAHY FAQGLEARLV GTGSQLYRSC  180
MGRRTSIVEL IKAYHLYNAT CCFVKMAMLF SNKTIYNAVA GRRKLHIVHY GINSGLQWPK  240
LIRWLAEREG GPPEIRITGI NMPQPGFNLA EQIKETGQRL SNYASKFGVS FKFHAIIAKL  300
EAVHAEDLHI DPDEVLIVNS LFQFRILMDE SLSFDNVSPR DMVLNNIRKM KPSMFIHGIA  360
NGSHSAAFFM TRFRQALSHF TALFDMMETI MQGNYDKRLR VERAIFAWCA INMIACEGVD  420
RVERPQNYRE WQVRKNRAGL RQLPLDSDTV LMLKNEVKNQ YHKHFMIDED HRWVLQGWKG  480
RVLYALSTWA ADDAGGSELS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-481214898374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575624.30.0PREDICTED: scarecrow-like protein 33
TrEMBLI1IJ290.0I1IJ29_BRADI; Uncharacterized protein
STRINGBRADI4G09235.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-131GRAS family protein