PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g09232.1.p
Common NameBRADI_4g09232
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 604aa    MW: 68036.1 Da    PI: 6.7939
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g09232.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3112.8e-952215932374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       ++lL++cAe vs +d + a ++L+r++  +sp+gd+ qR+a yf+++L+arla+++sely++l  ++ts   + e ++a++l   ++ +++++
  Bradi4g09232.1.p 221 ETLLIRCAESVSRNDRHSAIEVLERIKRYSSPRGDARQRVAYYFAQGLEARLAGTGSELYRSLVGKHTS---TLELVQAYHLQMATCCFVNVA 310
                       789***************************************************************999...899999*************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                        l  N +I++av+g +++Hi+ ++i  G +Wp L+q La+R++gpp++R T++++p++g   +e ++e g+rL+  A+++gvpf+f++ va +
  Bradi4g09232.1.p 311 SLFSNYTIYNAVAGRRKLHIVHYGIITGYKWPELIQRLADREGGPPEVRFTTINNPQPGfcPAELIKEAGHRLSACASKFGVPFKFHA-VAAK 402
                       ************************************************************99**************************.799* PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                       le+++ e+L+++p+E+l+V++ +q  ++ld++++ ++  +rd vL+++++++P v+v++  + +++++ F++rf +al+y++alfd++++ +p
  Bradi4g09232.1.p 403 LESVQAEDLHFDPDEVLIVHSLFQFRTMLDDNLTGDKvnPRDMVLNTIRKMKPSVFVHAVVNGSYSAALFMTRFRQALYYFTALFDMMDTAIP 495
                       *******************************988777779***************************************************** PP

              GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                       r +++r+ vEr  +++++ n++aceg++r+er +++++W+++ ++aG++++pl+ +++ + k  +++ +   ++v e++ ++++gWk+r L +
  Bradi4g09232.1.p 496 RGNDKRMLVERDSFAWSAINMIACEGTDRVERPQNYREWQAQNQRAGLRQLPLDCDIVLSLKDEVKNKYHTHFMVYEDHRWVLQGWKGRVLCA 588
                       ******************************************************************999888********************* PP

              GRAS 370 vSaWr 374
                       +  W+
  Bradi4g09232.1.p 589 LATWT 593
                       ****5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.59194573IPR005202Transcription factor GRAS
PfamPF035149.5E-93221593IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 604 aa     Download sequence    Send to blast
MAATREELLG VAEPAPLPPP THGDSQKPQN DLSLAYIVRM LMEDDTVDTF PDQYPDHPKL  60
LQAEQNFAQI LSAANITSAP GGALDTALLP SRDNNNNNST LFPGENSSTS KAFFKGMVDA  120
SMLLPRDNGV LDGRGYKKRF DMDDETEAGR GRGRSRTDSE EEDTALKMLD RLILNGYDKY  180
PGEMQDVLIT LDKEKNATQK RIRWRGRGGA RQTETTVTDL ETLLIRCAES VSRNDRHSAI  240
EVLERIKRYS SPRGDARQRV AYYFAQGLEA RLAGTGSELY RSLVGKHTST LELVQAYHLQ  300
MATCCFVNVA SLFSNYTIYN AVAGRRKLHI VHYGIITGYK WPELIQRLAD REGGPPEVRF  360
TTINNPQPGF CPAELIKEAG HRLSACASKF GVPFKFHAVA AKLESVQAED LHFDPDEVLI  420
VHSLFQFRTM LDDNLTGDKV NPRDMVLNTI RKMKPSVFVH AVVNGSYSAA LFMTRFRQAL  480
YYFTALFDMM DTAIPRGNDK RMLVERDSFA WSAINMIACE GTDRVERPQN YREWQAQNQR  540
AGLRQLPLDC DIVLSLKDEV KNKYHTHFMV YEDHRWVLQG WKGRVLCALA TWTVDDTSAS  600
EVT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-372245928374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575622.10.0PREDICTED: scarecrow-like protein 14
TrEMBLA0A0Q3EH530.0A0A0Q3EH53_BRADI; Uncharacterized protein
STRINGBRADI4G09235.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-116SCARECROW-like 14