PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g09196.1.p
Common NameLOC100845617
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 732aa    MW: 80376.1 Da    PI: 5.1083
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g09196.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS324.61.9e-993437211373
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l++ L++cA+av++gd++    lL+++++++sp+gd++qRla +f+e+L+arla+++s++y++l +++ts   ++e l a+kl+  +s + k+
  Bradi4g09196.1.p 343 LRTMLIHCAQAVATGDHRSSADLLSQVKQHCSPKGDATQRLAYCFAEGLEARLAGTGSQVYQSLMAKRTS---VVEYLRAYKLYMAASSFKKV 432
                       5789************************************************************999999...******************** PP

              GRAS  94 shltaNqaIleavege...ervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                             ++I++a++     +r+Hi+D+++++G+QWp Llq L+ R++gpp++RiTg++ p++g   + ++eetg+rL++ A+e+gvpf+f+  
  Bradi4g09196.1.p 433 NMAFVGKTIVDAMAPGkgrDRLHIVDYNVQYGFQWPGLLQWLSIREGGPPEVRITGIDLPQPGfrPAFQIEETGRRLTDCAREFGVPFKFHG- 524
                       *************633344*******************************************999***************************. PP

              GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles.....erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                       +a ++e+++ e+++++p+E l+V ++    +lldesv ++      +rd vL+ + +++P+v++ +  +  ++++ F++rf eal+yysa fd
  Bradi4g09196.1.p 525 IAAKWETVRAEDINIDPDEFLVVTSQAGFGNLLDESVVMDRqdipsPRDMVLNNIGKMRPDVFIDCVVNGTYGAPFFVTRFREALYYYSAQFD 617
                       799******************************99987766556669********************************************** PP

              GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                       +l+a++pr+++er  +Er ++gr + nvvacega+r+er et+++W+ r ++aG++++pl  +++k ++  +++++ + + ++ ++ +l++gW
  Bradi4g09196.1.p 618 MLDATIPRDNDERLLIERDIFGRCALNVVACEGADRVERPETYKQWQVRGHRAGMRQLPLCPEVVKVVRDKVKNYYHKDFVIDVDNRWLLQGW 710
                       ****************************************************************************889************** PP

              GRAS 363 kdrpLvsvSaW 373
                       k+r L+++S W
  Bradi4g09196.1.p 711 KGRVLYAMSTW 721
                       *********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.961317702IPR005202Transcription factor GRAS
PfamPF035146.6E-97343721IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 732 aa     Download sequence    Send to blast
MSPSLFLDLP PTPPRLLAAD APGDIDLDFI SRMLMEEDID DRFFYQYPDH PAILSAHRAF  60
AQIISDDRSA AATTSSDYCS SATTGAKSTP TTSSSDSPDA LSASPTAACW PRESPVDLSV  120
DSHAALPKGS GDDSFGAVDR NGTTSTAEKE KENGSKPATT ATFLAGGSDD GAFTASAFFN  180
GGGAMDDMLS LAFRKGMEEA SKFLPSATNN SLLVDPDSFS GGDQARKEEA DGLGTLMFGS  240
SNNGRSRKHR HSDDEAEAEA EAGRSRKVMA PEPEEVGTDA RQMFDEIMLH GYDSCMQGIE  300
DLRIAMGSEA ERNIRNGTGG KAAAVARRGK RRGAARSEPE VDLRTMLIHC AQAVATGDHR  360
SSADLLSQVK QHCSPKGDAT QRLAYCFAEG LEARLAGTGS QVYQSLMAKR TSVVEYLRAY  420
KLYMAASSFK KVNMAFVGKT IVDAMAPGKG RDRLHIVDYN VQYGFQWPGL LQWLSIREGG  480
PPEVRITGID LPQPGFRPAF QIEETGRRLT DCAREFGVPF KFHGIAAKWE TVRAEDINID  540
PDEFLVVTSQ AGFGNLLDES VVMDRQDIPS PRDMVLNNIG KMRPDVFIDC VVNGTYGAPF  600
FVTRFREALY YYSAQFDMLD ATIPRDNDER LLIERDIFGR CALNVVACEG ADRVERPETY  660
KQWQVRGHRA GMRQLPLCPE VVKVVRDKVK NYYHKDFVID VDNRWLLQGW KGRVLYAMST  720
WVAADDDKSR F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-383477218374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014758864.10.0PREDICTED: scarecrow-like protein 34
TrEMBLI1IJ240.0I1IJ24_BRADI; Uncharacterized protein
STRINGBRADI4G09197.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-145GRAS family protein