PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g09190.1.p
Common NameLOC100844700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 638aa    MW: 70743.4 Da    PI: 6.0013
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g09190.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS342.66.7e-1052606312373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                        +lLl+cA+avs++d++ a +lL+++++++sp+gd+ qRla+yf  +L+arla+ +sely++l +++ts   ++++l+a +l+  ++ + k+s
  Bradi4g09190.1.p 260 HTLLLQCAQAVSTDDQRGAGELLKKIKQNSSPTGDAAQRLAHYFSIGLEARLAGRGSELYESLMTRRTS---VVDVLKANQLYMAACCCRKVS 349
                       679**************************************************************9999...********************* PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                       +l   ++I++av+g +r+Hi+D++i+ GlQWpaLl+ La+R++gpp++RiTg++ p++g   +  +e tg+rL++fA+ +gvpf+f+  +a +
  Bradi4g09190.1.p 350 FLFSDKTIYNAVAGRSRLHIVDYGINLGLQWPALLRMLAAREGGPPEVRITGIDLPQPGfrGAYHIEDTGRRLSNFARVFGVPFKFHG-IAAK 441
                       **********************************************************999999************************.6999 PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                        e++++e+L+++p+E+l+V +  +  +l+de++  +s  +rd+vL+ +k+++P+v+++      ++++ Fl+rf eal +ysa fd l++++p
  Bradi4g09190.1.p 442 RETVRPEDLNIDPDEVLVVISLCHFRHLMDENLGFDSpsPRDQVLNNIKKMRPNVFIHGILSGAYGATYFLTRFREALFHYSAHFDQLDVTVP 534
                       9*******************************98887779***************************************************** PP

              GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                       r+++ r  +Er ++g+++ nv+acega+r+er et+++W+ r ++aG++++pl+ +++k +   ++  + + + v+e++ +lv+ Wk+r L++
  Bradi4g09190.1.p 535 RDNHGRLLLERDIFGPSALNVIACEGADRVERPETYKQWQLRHHRAGLSQLPLNPEVVKLVLDKVKDNYHKDFVVDEDQRWLVQRWKGRVLYA 627
                       *******************************************************************99888********************* PP

              GRAS 370 vSaW 373
                       +SaW
  Bradi4g09190.1.p 628 LSAW 631
                       **** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.295233612IPR005202Transcription factor GRAS
PfamPF035142.3E-102260631IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 638 aa     Download sequence    Send to blast
MAGGATPEEE FLRQSFLARL EPPSPSLFLD LPPTPGAAAA GEAGPSSSSF DDMVLPYISQ  60
LLMEEEDMVD HFFYLYPQHP ALLRAQLPFA QILQDNSSAG SAPTPSSSDS SSPADCRPEL  120
RAVQSSALPD GLLTGGDQDM LNLAFLKGME EARKFLPPNT GLPPVAAKAE DGLLKKKRGN  180
SEPEEAGRAS KLMAPELEEE EDGARELLDE MMFDQNEICM KGVQNLQVSE PVKKTRNRKG  240
TGQRGRPKNA SADDEMVDLH TLLLQCAQAV STDDQRGAGE LLKKIKQNSS PTGDAAQRLA  300
HYFSIGLEAR LAGRGSELYE SLMTRRTSVV DVLKANQLYM AACCCRKVSF LFSDKTIYNA  360
VAGRSRLHIV DYGINLGLQW PALLRMLAAR EGGPPEVRIT GIDLPQPGFR GAYHIEDTGR  420
RLSNFARVFG VPFKFHGIAA KRETVRPEDL NIDPDEVLVV ISLCHFRHLM DENLGFDSPS  480
PRDQVLNNIK KMRPNVFIHG ILSGAYGATY FLTRFREALF HYSAHFDQLD VTVPRDNHGR  540
LLLERDIFGP SALNVIACEG ADRVERPETY KQWQLRHHRA GLSQLPLNPE VVKLVLDKVK  600
DNYHKDFVVD EDQRWLVQRW KGRVLYALSA WVADDAA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-432636318374GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1281286LKKIKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575619.10.0PREDICTED: scarecrow-like protein 9 isoform X1
RefseqXP_014758577.10.0PREDICTED: scarecrow-like protein 9 isoform X1
RefseqXP_014758578.10.0PREDICTED: scarecrow-like protein 9 isoform X1
RefseqXP_014758579.10.0PREDICTED: scarecrow-like protein 9 isoform X1
TrEMBLI1IJ230.0I1IJ23_BRADI; Uncharacterized protein
STRINGBRADI4G09190.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-136GRAS family protein