PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g09180.1.p
Common NameLOC100844700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 628aa    MW: 69249 Da    PI: 6.7487
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g09180.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3312.3e-1012546212373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                        +lLl+cA+avs+++++ a++lL+++++++sp+gd+ qRla+yf  +L+arla+ +s+ly++l +++ts   ++++l+a++l+  ++ + k++
  Bradi4g09180.1.p 254 HTLLLQCAQAVSTDNQRGASELLKKIKQNSSPTGDAAQRLAHYFSVGLEARLAGRGSRLYESLMARRTS---VVDVLKADQLYMAACCCKKVA 343
                       679***************************************************************999...********************* PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                       ++ aN++I +av+g++r+Hi+D+    GlQWp Ll+ La+R++gpp++RiTg++ p++g   +  +e tg+rL++fA+ + vpf+f + +a +
  Bradi4g09180.1.p 344 FVFANKTICNAVAGKSRLHIVDY----GLQWPGLLRMLAAREGGPPEVRITGIDLPQPGfrGASHVEDTGRRLSNFARVFSVPFKFCA-IAAK 431
                       **********************5....89*****************************99999*************************.6999 PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                        e++++e+L+++p+E+l+V +  +   l+de++  +s  +rd+vL+ +++++P+v+++   + +++++ Fl+rf eal +ysa fd l+a++p
  Bradi4g09180.1.p 432 RETVRPEDLNIDPDEVLVVISLCHFRLLMDENLGFDSpsPRDQVLNNIRKMRPNVFIHGILNGSYGATYFLTRFREALFHYSAQFDLLDATVP 524
                       9******************************998877779***************************************************** PP

              GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                       r+++ r  +Er ++gr++ nv+acega+r+er et+++W+ r ++aG++++pl+ +++k +   +r  + + + v+e++ +lv  Wk+r L++
  Bradi4g09180.1.p 525 RDNSGRLLLERDIFGRSALNVIACEGADRVERPETYKQWQLRNHRAGLSQLPLNPEVVKLVLDKVRGNYHKDFVVDEDQRWLVHRWKGRVLYA 617
                       *********************************************************************888********************* PP

              GRAS 370 vSaW 373
                       +SaW
  Bradi4g09180.1.p 618 LSAW 621
                       **** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.191227602IPR005202Transcription factor GRAS
PfamPF035147.9E-99254621IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 628 aa     Download sequence    Send to blast
MAGGATPEEE HVRQSFLARL EPPSPSLFLD LPPTPRSSSS FDDMALPYIS RLLMEEEDMA  60
DHFFYLYPQH PALLRAQLPF AQILVNNSSA GSGSGSVPSP SSSDSSSASP HDAVQIAGPP  120
PCAPDGLLPG GDQDMLNLAF LKGMEEARKF LPRNTGLPPV VAASAEDGLL KTKRANSEPE  180
EVGRASKLMA PELEEEEDGA RELLDEMMLG ENEICMKGVP NLQVAEPVKK TRKGTGQRGR  240
PRKAAVDGEM VDLHTLLLQC AQAVSTDNQR GASELLKKIK QNSSPTGDAA QRLAHYFSVG  300
LEARLAGRGS RLYESLMARR TSVVDVLKAD QLYMAACCCK KVAFVFANKT ICNAVAGKSR  360
LHIVDYGLQW PGLLRMLAAR EGGPPEVRIT GIDLPQPGFR GASHVEDTGR RLSNFARVFS  420
VPFKFCAIAA KRETVRPEDL NIDPDEVLVV ISLCHFRLLM DENLGFDSPS PRDQVLNNIR  480
KMRPNVFIHG ILNGSYGATY FLTRFREALF HYSAQFDLLD ATVPRDNSGR LLLERDIFGR  540
SALNVIACEG ADRVERPETY KQWQLRNHRA GLSQLPLNPE VVKLVLDKVR GNYHKDFVVD  600
EDQRWLVHRW KGRVLYALSA WVADDAT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-402576218374GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1275280LKKIKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575618.10.0PREDICTED: scarecrow-like protein 9 isoform X2
RefseqXP_014758580.10.0PREDICTED: scarecrow-like protein 9 isoform X2
TrEMBLI1IJ220.0I1IJ22_BRADI; Uncharacterized protein
STRINGBRADI4G09180.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-134GRAS family protein