PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g09175.1.p
Common NameBRADI_4g09175
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 579aa    MW: 65332 Da    PI: 6.149
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g09175.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS317.82.2e-972045732373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                        +lL++cA+av + d + a +lL++++++asp+gd+ qRla  f+e+L+arla+++ ++y  l++++ts      ++ a+++f  ++ + +++
  Bradi4g09175.1.p 204 HTLLVHCARAVMD-DRQSAGELLKEIKQHASPTGDAAQRLAYWFAEGLEARLAGTGRQVYGLLTAESTS---ALARMEAYQAFMSTCCFRRVA 292
                       679********97.8999******************************************999888888...89999**************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                       +l aN+aI + + g +r+Hi+D+++ +G+QW  Ll+ La+R++gpp++RiT ++ p++g   +++++e+g+ L+++A+ lgvpf++++ v+ +
  Bradi4g09175.1.p 293 FLFANKAIFNVALGRSRLHIVDYGLRYGFQWQELLRWLAARDGGPPEVRITHIDIPQPGchPEKQMKEMGDWLTDIARDLGVPFKYRA-VMAQ 384
                       **********************************************************99999*************************.7999 PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                       ++++++e+L+++pgEalaVn  ++  +l+desv ++s  +rd+vL+ + +++P+v+v +  + ++ ++ Fl rf eal y+sa+fd+l+a++p
  Bradi4g09175.1.p 385 WQTVSIEDLDMEPGEALAVNDLFNFRTLMDESVVIASlnPRDAVLSNITKMEPDVFVQCIVNGSY-GTFFLSRFREALFYHSAVFDMLDATMP 476
                       *********************************9999999*************************.789************************ PP

              GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                       res+ r  +Er ++g+ + n++a eg++r+er et+++W+ r ++aG++++pl+ +++k a+ ++++ + + + ++e++++l++gWk+r L++
  Bradi4g09175.1.p 477 RESRLRLALERDVFGWVALNAIAYEGEDRVERGETYKHWQVRNQRAGLRQLPLNRETVKMARDIVKNDYHKDFVIDEDHQWLLQGWKGRILYA 569
                       *******************************************************************99888********************* PP

              GRAS 370 vSaW 373
                        S W
  Bradi4g09175.1.p 570 HSTW 573
                       **** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.246177554IPR005202Transcription factor GRAS
PfamPF035147.7E-95204573IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 579 aa     Download sequence    Send to blast
MAAPPVFPDL PLMTHGDGYN DHSTLQDHLA LPYITRILME EEDDVDDDHP ALLHAQQPFA  60
QILYSSSTLA SALLADQGDT SSPSSAIFKF KGADEVGSLL LLADREYSKD TFSTAFLKGM  120
EEANKFLPAN NNLTSDGQGK VKEKSGRGRK DRHDELDIEV GRTSKLVEAR ACAVFDQMRG  180
AVDNESGNNN KKGRKNKVHV VDLHTLLVHC ARAVMDDRQS AGELLKEIKQ HASPTGDAAQ  240
RLAYWFAEGL EARLAGTGRQ VYGLLTAEST SALARMEAYQ AFMSTCCFRR VAFLFANKAI  300
FNVALGRSRL HIVDYGLRYG FQWQELLRWL AARDGGPPEV RITHIDIPQP GCHPEKQMKE  360
MGDWLTDIAR DLGVPFKYRA VMAQWQTVSI EDLDMEPGEA LAVNDLFNFR TLMDESVVIA  420
SLNPRDAVLS NITKMEPDVF VQCIVNGSYG TFFLSRFREA LFYHSAVFDM LDATMPRESR  480
LRLALERDVF GWVALNAIAY EGEDRVERGE TYKHWQVRNQ RAGLRQLPLN RETVKMARDI  540
VKNDYHKDFV IDEDHQWLLQ GWKGRILYAH STWVAERR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-412075738374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014758581.10.0PREDICTED: scarecrow-like protein 14
TrEMBLA0A0Q3L3D20.0A0A0Q3L3D2_BRADI; Uncharacterized protein
STRINGMLOC_43730.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-123SCARECROW-like 14