PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g09170.1.p
Common NameBRADI_4g09170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 656aa    MW: 73587.8 Da    PI: 5.9362
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g09170.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS309.76.7e-952766462373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       +  Ll c + v++g+++ a+ lL++++++as +gd+ qRla++f+++L+arla+++s++y++l  ++ts     e l+ ++lf  ++ + +++
  Bradi4g09170.1.p 276 RGMLLCCSQEVATGNHQGASILLKQIRQHASARGDAAQRLAHCFAQGLEARLAGTGSQVYRSLVEKHTS---AMEFLKGYELFMAACCFKRVA 365
                       56899**********************************************************999999...99******************* PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                       +     +I +aveg++r+Hi+D+++ +G QWp Ll  La+R + pp++RiTg++ p++g   ++++eetg++L++ A+++g+pf+f++ ++ +
  Bradi4g09170.1.p 366 FTFSSMTIFNAVEGKSRLHIVDYGLHYGCQWPGLLCWLANRGGRPPKVRITGIDLPQPGfrPSKRIEETGKQLSNCARQFGLPFKFHA-ITAK 457
                       **********************************************************9*****************************.6999 PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                       +e++   +L+++p+E+l+Vn  ++  +l+des+ ++   +rd vL+++++++P+v++    + +  ++ Fl+rf e+l ++s++fd+l+a+ p
  Bradi4g09170.1.p 458 WETICAADLNIDPDEVLVVNELFNFNTLMDESLVTDRpsPRDVVLSTIRGMRPDVFIQGVVNGSS-GPFFLARFRESLFFHSSVFDMLDATTP 549
                       ********************************98776669****************998888776.89************************* PP

              GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                       r+se+r ++Er ++g+ + n+vacega+r+er et+++W+ r ++aG++++pl+ ++++ a   ++  + + + v+ ++g+l++gWk+r L++
  Bradi4g09170.1.p 550 RDSEHRLVLERDMFGQCALNAVACEGADRVERPETYKQWQLRNQRAGLRQLPLRPSVVEVATDKVKSLYHKDFLVDVDQGWLLQGWKGRILYA 642
                       *********************************************************************888********************* PP

              GRAS 370 vSaW 373
                        SaW
  Bradi4g09170.1.p 643 HSAW 646
                       **** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.725249627IPR005202Transcription factor GRAS
PfamPF035142.3E-92276646IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 656 aa     Download sequence    Send to blast
MECSTITSSE FTTMPVTSEE LLGLTESVPP SPSLYLDIPP TPYDASVGDL VLPYIARILM  60
EEDIDDRFFY QYPDHPALLR AQQPFAQILD EAKNLLSNED GDMERMNSDV SLQGAHGGSM  120
FLAGKDIRNW AILDGAEVDN NGDQRKLSLC NEDMLNLAFL KGMEEANKFL PRDNNLQVSA  180
FSIGQAREML VRSTSGRRRC DVEEVVGRAS KLMVLDLEED GAHELMQKLM LNSCEFRGEA  240
MQKLRITMEK TEAERRSMKA GRGRQQRKRG DTVDLRGMLL CCSQEVATGN HQGASILLKQ  300
IRQHASARGD AAQRLAHCFA QGLEARLAGT GSQVYRSLVE KHTSAMEFLK GYELFMAACC  360
FKRVAFTFSS MTIFNAVEGK SRLHIVDYGL HYGCQWPGLL CWLANRGGRP PKVRITGIDL  420
PQPGFRPSKR IEETGKQLSN CARQFGLPFK FHAITAKWET ICAADLNIDP DEVLVVNELF  480
NFNTLMDESL VTDRPSPRDV VLSTIRGMRP DVFIQGVVNG SSGPFFLARF RESLFFHSSV  540
FDMLDATTPR DSEHRLVLER DMFGQCALNA VACEGADRVE RPETYKQWQL RNQRAGLRQL  600
PLRPSVVEVA TDKVKSLYHK DFLVDVDQGW LLQGWKGRIL YAHSAWVADD TSSDD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-392796468374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575617.30.0PREDICTED: scarecrow-like protein 9
TrEMBLA0A0Q3EKY50.0A0A0Q3EKY5_BRADI; Uncharacterized protein (Fragment)
STRINGBRADI4G09170.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-138GRAS family protein