PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g09160.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 642aa    MW: 71717.5 Da    PI: 5.6668
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g09160.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS321.91.3e-982616321373
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l+ lLl+cA+ v+ ++++ a +lL++++++as +gd++qRla++f+ +L+ar+a+++s++yk+l +++ts    +e l  ++lf  ++ + ++
  Bradi4g09160.3.p 261 LRALLLSCAQEVAISNHQGAGNLLKQIRQHASATGDATQRLAHCFAMGLEARMAGTGSKVYKTLVAKQTS---AIEFLRGYELFMAACSFRRV 350
                       5789*****************************************************************9...9******************* PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvak 184
                       +      +I  a+ g++r+Hi+D+++ +G QWp Ll  LasR++gpp++RiTg++ p++g   ++++eetg+rL++ A+++g+pf+f++ +a 
  Bradi4g09160.3.p 351 ALTFSSMTIFHAMRGKKRLHIVDYGVHYGCQWPGLLCWLASRDGGPPEVRITGIDLPQPGfrPAKRIEETGQRLSNCARQFGLPFKFHA-IAA 442
                       ***********************************************************9*****************************.799 PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                       ++e+++ e+L+++p+E+l+Vn  ++  +l+des+ ++   +rd vL+++++++P+v++    + +  ++ Fl+rf eal ++s++fd+l+a+ 
  Bradi4g09160.3.p 443 KWETIRAEDLNIEPDEVLVVNDLFNFNTLMDESLVTDRpsPRDVVLSTIRGMRPDVFIQGVVNGSS-GPFFLARFREALFFHSSVFDMLDATT 534
                       *********************************98776669****************998888776.89************************ PP

              GRAS 276 preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLv 368
                       prese+r ++Er ++g+ + n++acega+r+er et+++W+ r ++aG++++pl+  + + a   ++  + + + v+ ++g+l++gWk+r L+
  Bradi4g09160.3.p 535 PRESEHRLVLERDMFGQCALNAIACEGADRVERPETFKQWHLRNQRAGLRQLPLRPIVIEVATGKVKSLYHKDFVVDVSQGWLLQGWKGRILY 627
                       **********************************************************************888******************** PP

              GRAS 369 svSaW 373
                       + SaW
  Bradi4g09160.3.p 628 AHSAW 632
                       ***** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.881235613IPR005202Transcription factor GRAS
PfamPF035144.4E-96261632IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 642 aa     Download sequence    Send to blast
MMPITPEELL ETVPPSPSIY LDIPPSPYGG NVGDMVLPYI SRILMEEDID ERFFYQYPDH  60
PALLRAQQPF AEILNEARNL LSSEGSDIER MNSDSSLQGG CGSSMFLAGK DDIQSRAIFD  120
AAEVDNNGYQ SKLGLSNEDM LNMSFLKGME EASKFLPRDN NLQVSAFSVG QPKEMFDRSA  180
SGRERCDGEE VVGRASKLMV IELEEDGAHE MFEKAMLNSC DLSGETMEKL HIDMENAEAN  240
RRNKKAVRGR QQGKRGDTVD LRALLLSCAQ EVAISNHQGA GNLLKQIRQH ASATGDATQR  300
LAHCFAMGLE ARMAGTGSKV YKTLVAKQTS AIEFLRGYEL FMAACSFRRV ALTFSSMTIF  360
HAMRGKKRLH IVDYGVHYGC QWPGLLCWLA SRDGGPPEVR ITGIDLPQPG FRPAKRIEET  420
GQRLSNCARQ FGLPFKFHAI AAKWETIRAE DLNIEPDEVL VVNDLFNFNT LMDESLVTDR  480
PSPRDVVLST IRGMRPDVFI QGVVNGSSGP FFLARFREAL FFHSSVFDML DATTPRESEH  540
RLVLERDMFG QCALNAIACE GADRVERPET FKQWHLRNQR AGLRQLPLRP IVIEVATGKV  600
KSLYHKDFVV DVSQGWLLQG WKGRILYAHS AWVADDTSSD D*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-382656328374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010238971.10.0PREDICTED: scarecrow-like protein 34
TrEMBLI1IJ200.0I1IJ20_BRADI; Uncharacterized protein
STRINGBRADI4G09160.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-135GRAS family protein