PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g09157.1.p
Common NameBRADI_4g09157
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 587aa    MW: 66787.3 Da    PI: 8.6741
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g09157.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS322.58.7e-992055762373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       + lL++cAeav+s+d++ a++lL+r++ ++sp+gd  qRla+yf+++L+arla++ s+ly++l  s++s   ++e ++a +l++ +s ++k++
  Bradi4g09157.1.p 205 EMLLIRCAEAVASNDKRSASELLERIKWHSSPTGDDRQRLAHYFAQGLEARLAGTRSRLYRSLMGSHNS---TVELMKACHLYVTTSCFVKMA 294
                       579*********************************************************999998888...8999***************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                           N++I++av+g +++Hi+ ++i  G QWp L++ La+R++gpp++RiT ++ p+++   +e++ee ++rL+ +A+++g++f+f++ +a +
  Bradi4g09157.1.p 295 LHFSNKTIYNAVAGRKKLHIVHYGIDTGSQWPKLIRWLADRDGGPPEVRITNINTPRPKcrLSEQIEEPEHRLRTYASKFGMSFKFRA-IAAK 386
                       *********************************************************9998899************************.6999 PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                        e+++ e+L+++ +E+l+Vn+++q  +l+des+  +   +rd vL+ +++++P v+v++  + +++++ F++rf +al+y++alfd +e+ +p
  Bradi4g09157.1.p 387 PEAVQAEDLQIDLDEVLVVNSIFQFRTLMDESLRFDRvsPRDMVLNNIRKMKPSVIVHAIVNGSYSTPFFMTRFRQALYYFTALFDVMETAIP 479
                       ********************************9988777****************************************************** PP

              GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                       r+s++r  vEr +++++++n++acega+r+er +++++W++r ++aG++++pl+++++   k   +++  + ++++e++++l++gWk+r L++
  Bradi4g09157.1.p 480 RDSNKRLLVERDIFAQSAMNIIACEGADRVERPQNYREWQARNNRAGLRQLPLDQDIVLMLKDEAKNHCHKHFMINEDHQWLLQGWKGRVLYA 572
                       *****************************************************************9999899********************* PP

              GRAS 370 vSaW 373
                       +S W
  Bradi4g09157.1.p 573 LSTW 576
                       **** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.512178557IPR005202Transcription factor GRAS
PfamPF035143.0E-96205576IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 587 aa     Download sequence    Send to blast
MEDDIVDNFS YQYPDHLKLL QAEQPFAQIL SAGATTSSKT DESLAHGMLA STLLPSKVQD  60
PAFLLNGTVS VKHSSTLFPI ESSTGMIKMS SNAFFKGMEE PNMFLPRENV MVHGRGRKNR  120
FDMDGETEAG MGRSRKQIAM AHTDSEEEAT TVAMLDRLIL NAYDMYPSEM QEACVTLDKE  180
NKVAQKRTCK RGRRGARQTV VTDLEMLLIR CAEAVASNDK RSASELLERI KWHSSPTGDD  240
RQRLAHYFAQ GLEARLAGTR SRLYRSLMGS HNSTVELMKA CHLYVTTSCF VKMALHFSNK  300
TIYNAVAGRK KLHIVHYGID TGSQWPKLIR WLADRDGGPP EVRITNINTP RPKCRLSEQI  360
EEPEHRLRTY ASKFGMSFKF RAIAAKPEAV QAEDLQIDLD EVLVVNSIFQ FRTLMDESLR  420
FDRVSPRDMV LNNIRKMKPS VIVHAIVNGS YSTPFFMTRF RQALYYFTAL FDVMETAIPR  480
DSNKRLLVER DIFAQSAMNI IACEGADRVE RPQNYREWQA RNNRAGLRQL PLDQDIVLML  540
KDEAKNHCHK HFMINEDHQW LLQGWKGRVL YALSTWAVDD SGGSEK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-392085768374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575614.20.0PREDICTED: scarecrow-like protein 33
TrEMBLA0A0Q3H1200.0A0A0Q3H120_BRADI; Uncharacterized protein
STRINGBRADI4G09235.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-121GRAS family protein