PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g09156.1.p
Common NameBRADI_4g09156
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 589aa    MW: 66829.5 Da    PI: 8.5242
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g09156.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS325.97.7e-1002065772373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       ++lL++cAeavs++d ++a++lL+r+++++sp+gd+ qRla+yf+++L+arla+++s+ly++l  +++    ++e ++a++l++ +s ++k++
  Bradi4g09156.1.p 206 ETLLTRCAEAVSNNDRRNASELLERIKQHSSPKGDARQRLAHYFAKGLEARLAGTGSHLYRSLMGTHNC---TVELMKAYHLYVTTSCFFKMA 295
                       689*********************************************************999877776...89******************* PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                        l  N++I++av+g +++Hi+ ++i  G QWp L++ LasR++gpp++RiT ++ p+++   +e++ee  +rL+++A+++gv+f+f++ +a +
  Bradi4g09156.1.p 296 VLFSNKTIYNAVAGRKKLHIVHYGIDTGSQWPKLIRWLASREGGPPEVRITNINTPRPKcrLSEKIEEPDRRLSNYASNFGVSFKFHA-IAAK 387
                       *********************************************************9998899************************.6999 PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                        e+++ e+L+++p+E+l+V++ +q   l+de+++     +rd vL+++++++P v++++  + +++++ F++rf + l+y+++lfd +e+++p
  Bradi4g09156.1.p 388 PEAVQAEDLQIDPDEVLVVSSLFQSRLLMDETLTFGGvnPRDMVLNTIRKMKPSVFIHAVVNGSYSAAFFMTRFRQVLYYFMTLFDVIETTIP 480
                       *********************************9987779***************************************************** PP

              GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                       +++++r  vEr ++++ ++n++acega+r+er +++++W++r ++aG++++pl+ +++   k  ++++  + ++++e++++l++gWk+r L++
  Bradi4g09156.1.p 481 QDNDKRLLVERDIFAQCAMNIIACEGANRVERPQNYREWQARNQRAGLRQLPLDPNIVLMLKDEVKEHCHKHFMINEDHQWLLQGWKGRVLYA 573
                       *******************************************************************99999********************* PP

              GRAS 370 vSaW 373
                       +S W
  Bradi4g09156.1.p 574 LSTW 577
                       **** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.401179558IPR005202Transcription factor GRAS
PfamPF035142.6E-97206577IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 589 aa     Download sequence    Send to blast
MMMEDDIVDK FSYQYPDHLK LLQAEQPFAH ILTATASTSP DVEESTAPNT ISSALLPNKV  60
HDPAFVSNGT GVVESISILF PYESSINVNR MSSMAFFKGM EEAKMFLPRD NAMLDGRGRK  120
NRFDMDGEME AGMGRSRKQI AVHTDLEEEA TTLAMLDRLI LNTYDLYPSE MQEVHVTINR  180
ENKAAQKSIC RRGRRGARQT MVTGLETLLT RCAEAVSNND RRNASELLER IKQHSSPKGD  240
ARQRLAHYFA KGLEARLAGT GSHLYRSLMG THNCTVELMK AYHLYVTTSC FFKMAVLFSN  300
KTIYNAVAGR KKLHIVHYGI DTGSQWPKLI RWLASREGGP PEVRITNINT PRPKCRLSEK  360
IEEPDRRLSN YASNFGVSFK FHAIAAKPEA VQAEDLQIDP DEVLVVSSLF QSRLLMDETL  420
TFGGVNPRDM VLNTIRKMKP SVFIHAVVNG SYSAAFFMTR FRQVLYYFMT LFDVIETTIP  480
QDNDKRLLVE RDIFAQCAMN IIACEGANRV ERPQNYREWQ ARNQRAGLRQ LPLDPNIVLM  540
LKDEVKEHCH KHFMINEDHQ WLLQGWKGRV LYALSTWAAD NSSGSKIA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-352055775374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575613.30.0PREDICTED: scarecrow-like protein 33
TrEMBLA0A0Q3PCY90.0A0A0Q3PCY9_BRADI; Uncharacterized protein
STRINGBRADI4G09155.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-125GRAS family protein