PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g09155.1.p
Common NameLOC100842884
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 584aa    MW: 66180.4 Da    PI: 8.3038
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g09155.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS334.81.5e-1022035752374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       ++lL++cAeavss+d   a++lL r++ ++sp+gd+ qRla+yf+++L+ar+a+++s+ly++l  ++ts   + e ++a++l   ++ +lk++
  Bradi4g09155.1.p 203 ETLLIRCAEAVSSNDRGSASELLMRIKRHSSPSGDARQRLAHYFAQGLEARMAGTGSQLYHSLIGTRTS---TLELIKAYHLHMATCSFLKVA 292
                       579************************************************************888887...89******************* PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                        +  N +I++av+g +++Hi+ ++i+ G QW+ L++ La+R++gpp++RiTg+++p++g   +e +ee g+rL+k+A+++gvpf+f++ va +
  Bradi4g09155.1.p 293 LIFSNYTIYNAVAGRRKLHIVHYGINTGYQWARLIRRLADREGGPPEVRITGINRPQPGfrPAELIEEAGHRLSKYARKCGVPFKFHA-VAAQ 384
                       ************************************************************9999************************.7999 PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                        e+++ e+L+++p+E+l+V + +   +l+des++ +   +rd vL++++ ++P v+v++  + +++++ F++rf +a+++++alfd +e+++p
  Bradi4g09155.1.p 385 PEAVRAEDLHIDPDEVLVVDSLFDFRTLMDESLTFDRvnPRDVVLNTIRMMKPSVFVHAIVNGSYSAAFFMTRFRQAMYFFTALFDVMETTFP 477
                       ********************************99887779***************************************************** PP

              GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                       r++ +r  +Er +++r++vn++aceg+er+er +++++W++r ++aG++++pl+ ++    k  +++ + + ++++e++g+l++gWk+r L++
  Bradi4g09155.1.p 478 RDNAKRLLLERDIFARSAVNMIACEGTERVERPQNYREWQARNQRAGMRQLPLDPDILLMLKEKVKNQYHKHFMINEDQGWLLQGWKGRVLYA 570
                       *********************************************************************999********************* PP

              GRAS 370 vSaWr 374
                       +  W+
  Bradi4g09155.1.p 571 LATWT 575
                       ****5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.994176555IPR005202Transcription factor GRAS
PfamPF035145.3E-100203575IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 584 aa     Download sequence    Send to blast
MEDDIVDKFS YQYPDHPKLL QAEQPFAQIL TATASTSPNA EESSASNTIS SALMLSKVQD  60
PSFFSNGTDA VGPSSTFFSI ESSTNMNKMS SMAFFKGMEQ AKMFLPSDNL MVDGRGQKKR  120
FDMDGETEAG MDRSSKQIAM THTDLEDTAL KKMDRLILNE YDGYRGEMHE ELITLDNENK  180
AAQQSIRMRG RRSAKKTMVT DFETLLIRCA EAVSSNDRGS ASELLMRIKR HSSPSGDARQ  240
RLAHYFAQGL EARMAGTGSQ LYHSLIGTRT STLELIKAYH LHMATCSFLK VALIFSNYTI  300
YNAVAGRRKL HIVHYGINTG YQWARLIRRL ADREGGPPEV RITGINRPQP GFRPAELIEE  360
AGHRLSKYAR KCGVPFKFHA VAAQPEAVRA EDLHIDPDEV LVVDSLFDFR TLMDESLTFD  420
RVNPRDVVLN TIRMMKPSVF VHAIVNGSYS AAFFMTRFRQ AMYFFTALFD VMETTFPRDN  480
AKRLLLERDI FARSAVNMIA CEGTERVERP QNYREWQARN QRAGMRQLPL DPDILLMLKE  540
KVKNQYHKHF MINEDQGWLL QGWKGRVLYA LATWTADDTS GPV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-402065748374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575612.30.0PREDICTED: scarecrow-like protein 33
TrEMBLI1IJ190.0I1IJ19_BRADI; Uncharacterized protein
STRINGBRADI4G09155.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-138GRAS family protein