PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g09148.1.p
Common NameBRADI_4g09148
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 605aa    MW: 68674.1 Da    PI: 7.0288
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g09148.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS338.41.3e-1032225942374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       ++lL++cAeav+ +d + a++lL+r++  +sp+gd+ qR+a+yf ++L+arla+++++ y+  + ++ts   + e ++a+++   ++ +++++
  Bradi4g09148.1.p 222 ETLLIRCAEAVACNDRRSASELLERIKRYCSPTGDARQRVAHYFSQGLEARLAGTGTQFYRLSTGTRTS---TLELVKAYHMHMATCCFITVA 311
                       789***************************************************999999755555555...8999***************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                        l  N +I++av+g +++Hi+ ++i+ G QWp L++ La+R++gpp++RiTg+++p++g   +  +ee g+rL+++A+++gvpf+f++ +a +
  Bradi4g09148.1.p 312 LLFSNDTIYNAVKGRRKLHIVHYGINTGYQWPKLIRRLAEREGGPPEVRITGINRPQPGirPAGLIEEAGDRLSNYANKFGVPFKFHA-IAAE 403
                       ***********************************************************9999999**********************.6999 PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                        e+++ e+L+++p+E+l+Vn+ +   +l+des++ ++  +rd vL+++++++P v+v++  + +++++ F++rf +al+y++alfd++e+++p
  Bradi4g09148.1.p 404 PEAVRAEDLHIDPDEVLVVNSLFDFRTLMDESLTFDEvnPRDMVLNTIRKMKPSVFVHAVVNGSYSAAFFMTRFRQALYYFTALFDMMETTFP 496
                       *********************************9998889***************************************************** PP

              GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                       +++++r+ vEre+++r+++n++acega+r+ r  ++++W++r ++aG++++pl+++++   k  +++ + + ++++e++++l++gWk++ L++
  Bradi4g09148.1.p 497 EDNNKRVLVEREIFARSAMNMIACEGADRVDRPHNYKEWQARNQRAGLRQMPLNHDIVLMLKEEVKNQYHKNFMINEDHQWLLQGWKGQVLYA 589
                       *********************************************************************999********************* PP

              GRAS 370 vSaWr 374
                       +S W+
  Bradi4g09148.1.p 590 LSTWT 594
                       ****5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.595195574IPR005202Transcription factor GRAS
PfamPF035144.5E-101222594IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 605 aa     Download sequence    Send to blast
MLMEEDITDK FLYQYPDSPK LQQAEQPFAQ ILSAAATASF GAQESSAPSM LASDLMHSQD  60
NKTDIHVSGF LSCKVQDPAF LNGIYATDPE STLFPSERSA SMDKLSSMAF FKGMEEANMF  120
LPRDKKMVDG RVRKNRFDMD GETEGGMGRS SKQIAVLVQS DSEEEDTLKM LDRLILNGYD  180
NRPGEMREVR ATLYKENKAP KKSIPRRGRR SGAKQTVVTD LETLLIRCAE AVACNDRRSA  240
SELLERIKRY CSPTGDARQR VAHYFSQGLE ARLAGTGTQF YRLSTGTRTS TLELVKAYHM  300
HMATCCFITV ALLFSNDTIY NAVKGRRKLH IVHYGINTGY QWPKLIRRLA EREGGPPEVR  360
ITGINRPQPG IRPAGLIEEA GDRLSNYANK FGVPFKFHAI AAEPEAVRAE DLHIDPDEVL  420
VVNSLFDFRT LMDESLTFDE VNPRDMVLNT IRKMKPSVFV HAVVNGSYSA AFFMTRFRQA  480
LYYFTALFDM METTFPEDNN KRVLVEREIF ARSAMNMIAC EGADRVDRPH NYKEWQARNQ  540
RAGLRQMPLN HDIVLMLKEE VKNQYHKNFM INEDHQWLLQ GWKGQVLYAL STWTVDDTSG  600
SEET*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-422255938374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575611.20.0PREDICTED: scarecrow-like protein 33
TrEMBLA0A0Q3EH210.0A0A0Q3EH21_BRADI; Uncharacterized protein
STRINGBRADI4G09155.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-137GRAS family protein