PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g09146.1.p
Common NameBRADI_4g09146
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 570aa    MW: 64426.8 Da    PI: 9.169
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g09146.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS339.84.8e-1041875582373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       ++lL++cAeav++++ + a +lL r++ ++sp+gd++qRla+yf+e+L+ar+a+ +s+ly++l +++++   s+e l+a+klf  ++ +lk+s
  Bradi4g09146.1.p 187 ETLLIRCAEAVATNNRRSACELLGRIKWHSSPRGDATQRLAHYFAEGLEARMAGRGSHLYRSLMAKHAP---SVELLKAYKLFMSACCFLKVS 276
                       789**************************************************************9999...9******************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                       ++  N++I++ ++g +++Hi+ ++ + G+QW aLl+ La R++gpp++RiTg+ s ++g   +e++e +g+rL + A+++gvpf++++ ++ +
  Bradi4g09146.1.p 277 FMFSNKMIYKTIAGRKKLHIVHYGSNDGFQWSALLRCLAGRKGGPPEVRITGITSLRPGfrPAEQIEDIGRRLIECAKQFGVPFKYRA-IEAK 368
                       *******************************************************999999***************************.6999 PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                        ed+++e+L+++p+E+l+Vn+ l+  +l+desv +++  +rd vL+++++++P +++++  +a++n++ F++rf + l++++a fd +e++++
  Bradi4g09146.1.p 369 SEDVQIEDLKINPDEVLVVNSLLNFRSLMDESVVIDKlnPRDMVLNTIRKMKPAMFIHAIVNASYNTTFFVTRFRQVLHHFAAHFDIMETTVS 461
                       **********************************999999***************************************************** PP

              GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                       r++++r  vEr +++r+++n++aceg++r+er +++++W++r ++aG++++pl+ +++++ k  +++ + + + v+e++++l++gWk+r L++
  Bradi4g09146.1.p 462 RDNDKRLLVERDIFARSAMNIIACEGTDRVERPQNYREWQARNRRAGLRQLPLDPDIVQTLKDNVKRQHHKHFVVDEDHQWLLQGWKGRVLYA 554
                       *********************************************************************999********************* PP

              GRAS 370 vSaW 373
                       +S W
  Bradi4g09146.1.p 555 LSTW 558
                       **** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.304160539IPR005202Transcription factor GRAS
PfamPF035141.7E-101187558IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 570 aa     Download sequence    Send to blast
MKEDIVDKFL HQYPNHAALQ QAQHPFDQIL SASDTTTTSY AQQSSTPNML ASASVLPICN  60
IQNPAFFLNG MGAGEPNRSM DVISSMAFFR GMEEANRFLP TDGRMVDGDR TSKKMVVQVL  120
PETEEEATAG KMLDQLMLGG HDTCPTEARK RRSPTVEQDD RVGNENISRK APSGRRSMTL  180
AVVADLETLL IRCAEAVATN NRRSACELLG RIKWHSSPRG DATQRLAHYF AEGLEARMAG  240
RGSHLYRSLM AKHAPSVELL KAYKLFMSAC CFLKVSFMFS NKMIYKTIAG RKKLHIVHYG  300
SNDGFQWSAL LRCLAGRKGG PPEVRITGIT SLRPGFRPAE QIEDIGRRLI ECAKQFGVPF  360
KYRAIEAKSE DVQIEDLKIN PDEVLVVNSL LNFRSLMDES VVIDKLNPRD MVLNTIRKMK  420
PAMFIHAIVN ASYNTTFFVT RFRQVLHHFA AHFDIMETTV SRDNDKRLLV ERDIFARSAM  480
NIIACEGTDR VERPQNYREW QARNRRAGLR QLPLDPDIVQ TLKDNVKRQH HKHFVVDEDH  540
QWLLQGWKGR VLYALSTWVA DDASSSEVT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-451905588374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575610.30.0PREDICTED: scarecrow-like protein 33
TrEMBLA0A0Q3EH410.0A0A0Q3EH41_BRADI; Uncharacterized protein
STRINGBRADI4G09155.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-136GRAS family protein