PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g09144.1.p
Common NameBRADI_4g09144, LOC100841969
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 647aa    MW: 73044 Da    PI: 6.7195
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g09144.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS312.59.3e-962646352373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       ++lL++cAeavs +d   a++lL+r++  +sp+gd+ qRla+yf+++L+arla+++s+ly++l  ++     ++e ++a+ l   ++ +++++
  Bradi4g09144.1.p 264 ETLLIRCAEAVSRNDRGGASELLERIRRYSSPRGDASQRLAHYFAQGLEARLADTGSQLYRSLIGKHLC---TVELVQAYYLHMATCCFINVA 353
                       789************************************************************999998...89999**************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                        l  N +I++av+g +++Hi+ +++  G +Wp L+q La+R++gpp++RiT++++p++g   +e +ee g+rL++ A ++gv+f+f++ +a +
  Bradi4g09144.1.p 354 GLFSNCTIYNAVAGRRKLHIVHYGMITGYKWPLLIQRLADREGGPPEVRITAINNPQPGfrPAEPIEEAGHRLRNCAMKFGVSFKFHA-IAAK 445
                       ************************************************************9***************************.6999 PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                        e ++ e+L+++p+E+l+Vn+ +q  +l de ++ +   +rd vL+++++++P v++++  + +++++ F++rf +al+ ++alfd +++++p
  Bradi4g09144.1.p 446 PEVVHAEDLHIDPDEVLVVNSLFQFRTLIDECLTFDRvsPRDMVLNTIRKMKPSVFIHAVVNGSYSAAFFMTRFRQALYNFTALFDVMDTTIP 538
                       *******************************98877666****************************************************** PP

              GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                       r+++ r +vEr ++++++ n++aceg++r+er  ++++W++r ++aG++++pl+ ++    k  l++ + + ++++e++++l++gWk+r L++
  Bradi4g09144.1.p 539 RDNNSRLVVERDIFAWSAINMIACEGTDRVERPHHYREWQARNQRAGLRQLPLDPDIFVMLKDELKNKYHKHFMIDEDHQWLLQGWKGRVLYA 631
                       **************************************************************9999999899********************* PP

              GRAS 370 vSaW 373
                       +S W
  Bradi4g09144.1.p 632 LSTW 635
                       **** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.79237616IPR005202Transcription factor GRAS
PfamPF035143.2E-93264635IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 647 aa     Download sequence    Send to blast
MDAKPEELVD FIEPAPLPPS IFLDLPQTTH GDSKQLQDDM SLTYISHMLM EDDINDKLSY  60
KYTDHLKLLR AEQPFAQILS AAANTSLGAQ DCSAPDAFVS ALMPNQDNNK DSIDCELLSS  120
EVQDPTFLNG TDLVKSNSTQ FPGENNSSTS MAFFKGMEEA SMLLPKHNGM SDRRGHKNRF  180
GVDGETAASM GRSSKQIAVL VHTDSEEDTA LQMLDRLILN GYNKHPSEMQ DVLITLDKEN  240
KAAQKSIHRR GRRRATQPVL TDLETLLIRC AEAVSRNDRG GASELLERIR RYSSPRGDAS  300
QRLAHYFAQG LEARLADTGS QLYRSLIGKH LCTVELVQAY YLHMATCCFI NVAGLFSNCT  360
IYNAVAGRRK LHIVHYGMIT GYKWPLLIQR LADREGGPPE VRITAINNPQ PGFRPAEPIE  420
EAGHRLRNCA MKFGVSFKFH AIAAKPEVVH AEDLHIDPDE VLVVNSLFQF RTLIDECLTF  480
DRVSPRDMVL NTIRKMKPSV FIHAVVNGSY SAAFFMTRFR QALYNFTALF DVMDTTIPRD  540
NNSRLVVERD IFAWSAINMI ACEGTDRVER PHHYREWQAR NQRAGLRQLP LDPDIFVMLK  600
DELKNKYHKH FMIDEDHQWL LQGWKGRVLY ALSTWVADHA SSSNVT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-412676358374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575609.30.0PREDICTED: scarecrow-like protein 33
TrEMBLA0A0Q3L3C30.0A0A0Q3L3C3_BRADI; Uncharacterized protein
STRINGBRADI4G09155.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-133GRAS family protein