PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g09142.1.p
Common NameBRADI_4g09142
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 600aa    MW: 67998.4 Da    PI: 7.1874
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g09142.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS330.43.3e-1012185882373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       ++lL++cAeav+s+d   a++lL++++ ++sp+g++ qRla+yf ++L+arla+++s+ y++l  +  s   +++ ++a++l+s ++ ++k++
  Bradi4g09142.1.p 218 ETLLIRCAEAVASNDRCSASELLEQIKRNSSPRGNARQRLAHYFSQGLEARLAGTGSQSYRSLIGTGIS---TVDLIKAYHLYSATCCFVKVA 307
                       789**********************************************************99988888...8******************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg.skeeleetgerLakfAeelgvpfefnvlvakrl 186
                       +l  N++I++av+g++++Hi+ ++i+ G+QWp L++ La+R++gpp++R+T ++ p++g +  e  e g+rL+++A++lgvpf+f++ ++++ 
  Bradi4g09142.1.p 308 FLFSNKTIYNAVAGKKKLHIVHYGINTGVQWPDLIRWLADREGGPPEMRMTSINIPQAGfRPSEQIEAGHRLRNYASRLGVPFKFHA-IETKP 399
                       *********************************************************9999999999********************.6999* PP

              GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                       e+++ e+L+++p+E+l+Vn+++q  +l+d+s++ +   +rd vL+++++++P v+v++  +  ++++ F++rf +al+ +++ fd +e+ +pr
  Bradi4g09142.1.p 400 EAVQAEDLHIDPDEVLVVNSIFQFRTLMDDSLTFDRvnPRDMVLNTIRKMKPSVFVHAVTNGPYSAAFFMTRFRHALYNFMVSFDVMETMVPR 492
                       *******************************99887779****************************************************** PP

              GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsv 370
                       +++ r  vEr +++r ++n++aceg++r+er +++++W+ r+++aG++++pl+ +++   k  +++ + + ++++e++ +l++gWk+r L+++
  Bradi4g09142.1.p 493 DNDMRLQVERDIFARCAMNMIACEGTDRVERPQNYREWQTRIQRAGLRQLPLDPDIVLMLKDKVKNQYHKHFMINEDHRWLLQGWKGRVLYAL 585
                       ********************************************************************999********************** PP

              GRAS 371 SaW 373
                       S W
  Bradi4g09142.1.p 586 STW 588
                       *** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.057191569IPR005202Transcription factor GRAS
PfamPF035141.1E-98218588IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 600 aa     Download sequence    Send to blast
MEDDIVDKFS YQYPDHRKLL QTEKPFAQIL SAAATISSRA QESSAPLAPT LMPSQDNNMD  60
IMVSGFFSCE VQDPAFLNGT YVVESNSTLF PSDSSSSMDT NVAFFKGMQE ANMFLPRDNG  120
TGMVDGRGRK NRLEIDGEAE AGMGRSSKQI AVLVHSESEE DTTLKKRLDC LILNGYDRYP  180
GEMQEVLITL DRENKAAEKS IRMRGRRGVK QTVETDLETL LIRCAEAVAS NDRCSASELL  240
EQIKRNSSPR GNARQRLAHY FSQGLEARLA GTGSQSYRSL IGTGISTVDL IKAYHLYSAT  300
CCFVKVAFLF SNKTIYNAVA GKKKLHIVHY GINTGVQWPD LIRWLADREG GPPEMRMTSI  360
NIPQAGFRPS EQIEAGHRLR NYASRLGVPF KFHAIETKPE AVQAEDLHID PDEVLVVNSI  420
FQFRTLMDDS LTFDRVNPRD MVLNTIRKMK PSVFVHAVTN GPYSAAFFMT RFRHALYNFM  480
VSFDVMETMV PRDNDMRLQV ERDIFARCAM NMIACEGTDR VERPQNYREW QTRIQRAGLR  540
QLPLDPDIVL MLKDKVKNQY HKHFMINEDH RWLLQGWKGR VLYALSTWVA EDTTSSEVT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-422215888374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575608.30.0PREDICTED: scarecrow-like protein 33
TrEMBLA0A0Q3H1170.0A0A0Q3H117_BRADI; Uncharacterized protein
STRINGBRADI4G09155.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-132SCARECROW-like 14