PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g09138.1.p
Common NameBRADI_4g09138
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 576aa    MW: 65178 Da    PI: 6.605
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g09138.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS53.83.8e-17220287269
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppset 69 
                       ++ L++cAeav+s+d+  a+ lL+r++ ++sp+g++ qRla+yf+++L+arla+++sely++l  + t
  Bradi4g09138.1.p 220 ETMLIRCAEAVASNDHCSASDLLERIKRHSSPKGNARQRLAHYFAQGLEARLAGTGSELYHSLFGTCT 287
                       678*********************************************************99854444 PP

2GRAS222.12.8e-68304565106374
              GRAS 106 vegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                       v+g +++Hi+ ++i+ GlQWp L+q La+R++gpp++R+T +  p++g   +e++ee g+rL ++A+++g++f+f++ +a ++++++ e+L++
  Bradi4g09138.1.p 304 VAGRRKLHIVHYGINTGLQWPDLIQWLADREGGPPEVRMTSITGPQPGfrTSEQIEEAGHRLCNYASKFGMSFNFHT-IAVKTDAVRAEDLHI 395
                       67899******************************************9*99**************************.6999*********** PP

              GRAS 197 kpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEr 287
                       +p+E+ +Vn+ +q   l+des++ +   +rd+vL+ +++++P+v+v++  +  ++++ F++rf +al+ ++alfd++e+           +Er
  Bradi4g09138.1.p 396 DPDEVPVVNSLFQFRALMDESLTFDRvnPRDTVLNSIRKMKPNVFVHAVTNGPYSGAFFMTRFRHALYNFTALFDMMETM----------LER 478
                       *********************9988777**************************************************99..........7** PP

              GRAS 288 ellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                        l++r ++n++acega+r+er +++++W+ r ++aG++++pl+++++ + k+ +++ +   ++++e++++l++gWk+rpL+++S W+
  Bradi4g09138.1.p 479 DLFARCAMNMIACEGADRVERPQNYREWQTRNNRAGLRQLPLDHDIVLTLKSKVKNQYHTHFMINEDHQWLLQGWKGRPLYALSTWT 565
                       **********************************************************999*************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.224193545IPR005202Transcription factor GRAS
PfamPF035141.3E-14220287IPR005202Transcription factor GRAS
PfamPF035149.6E-66304565IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 576 aa     Download sequence    Send to blast
MEEDIVDKFS YQYPDHPKLL QIEQPFAQIL SAAATTASIA QESSTPGVLS SALMPRQDNN  60
KDIIVSGFLF SEVQDPAFLN GTDTVECNST LYPSESSNSL DMLPNMAFFK GMKEANMFLP  120
KDNRMVDVRR RKNRFDMDGG TEAGMGRSSK QIAVLVHTDS EEEAELKKML DQLILSGDDM  180
YASEMKEVLI TLDKENKGAQ KSFRMRGRRG LKQPVMNDLE TMLIRCAEAV ASNDHCSASD  240
LLERIKRHSS PKGNARQRLA HYFAQGLEAR LAGTGSELYH SLFGTCTITV ELMKAYHLSY  300
TTPVAGRRKL HIVHYGINTG LQWPDLIQWL ADREGGPPEV RMTSITGPQP GFRTSEQIEE  360
AGHRLCNYAS KFGMSFNFHT IAVKTDAVRA EDLHIDPDEV PVVNSLFQFR ALMDESLTFD  420
RVNPRDTVLN SIRKMKPNVF VHAVTNGPYS GAFFMTRFRH ALYNFTALFD MMETMLERDL  480
FARCAMNMIA CEGADRVERP QNYREWQTRN NRAGLRQLPL DHDIVLTLKS KVKNQYHTHF  540
MINEDHQWLL QGWKGRPLYA LSTWTADDAA DLSNS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-302235648374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575608.30.0PREDICTED: scarecrow-like protein 33
TrEMBLA0A0Q3EKX50.0A0A0Q3EKX5_BRADI; Uncharacterized protein
STRINGBRADI4G09155.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-113GRAS family protein