PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g04260.2.p
Common NameBRADI_4g04260, LOC100844731
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Dof
Protein Properties Length: 376aa    MW: 39091.1 Da    PI: 8.5087
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g04260.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.61.2e-37127184562
            zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                       +l+cprCds+ntkfCy+nnyslsqPr+fCkaCrryWt+GGalrnvPvGgg+r+n k+s
  Bradi4g04260.2.p 127 TLRCPRCDSANTKFCYFNNYSLSQPRHFCKACRRYWTRGGALRNVPVGGGCRRNTKRS 184
                       679***************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-30110176IPR003851Zinc finger, Dof-type
PfamPF027011.8E-31128182IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.273128182IPR003851Zinc finger, Dof-type
PROSITE patternPS013610130166IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MGFSSFPIFL DPPNWSQMQQ QPLQCLMSGG GGSDHDHHHH LIPPPSSQHQ QQLAPLPCNN  60
NPSNTNTATS GPPPSSLQHQ QPSSGDPAAQ PLAQAQAPSA QVAPSSGVTS MTERARLARV  120
PLPEPGTLRC PRCDSANTKF CYFNNYSLSQ PRHFCKACRR YWTRGGALRN VPVGGGCRRN  180
TKRSNSKKSS RSNNSQSQSQ ATSSATSSCS TTTATSASTT SAAAMQALPH HLALQLDASL  240
DGYHGHHAQL QFLPAFMQLQ QQQQGMMMQH GGHGGGYGHF ADGGVGDVGS AGQQQLPDGF  300
PRGMVASGLL AQLASIKMEE HGVANGGGGI GGGGGFQLGL QGAHEQYWPG SGGGGGGWPT  360
EFLSGFSSSS SGNVL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi4g04260.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3717792e-87AK371779.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2141F19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010237142.20.0dof zinc finger protein DOF2.2
TrEMBLA0A0Q3L1I00.0A0A0Q3L1I0_BRADI; Uncharacterized protein
STRINGBRADI4G04260.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.19e-36OBF-binding protein 3