PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g03867.1.p
Common NameBRADI_4g03867, LOC100836508
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 698aa    MW: 76512.1 Da    PI: 5.114
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g03867.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS301.32.3e-923686841318
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l++lL++cA+av+++d + a++lL++++ +a  dgd +qRla++f+e+L+arla+++  + ++l +++ s    ++ l+a++l+  +  + k+
  Bradi4g03867.1.p 368 LRTLLIHCAQAVATDDRRSATELLKQIKLHARHDGDGTQRLAHCFAEGLQARLAGTGGLVHQSLMATRIS---AVDMLKAYQLYMAAICFKKV 457
                       6789***************************************************888888777777776...9******************* PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvak 184
                       +++  N +I++a  g++++HiiD++i++G+QWp++l+ +++R++gpp++RiTg++ p++g   + ++eetg+rL+k+A+e++vpf++n+++++
  Bradi4g03867.1.p 458 CFIFSNFTIYNASLGKKKIHIIDYGIQYGFQWPCFLRRISEREGGPPEVRITGIDLPQPGfrPAGRIEETGRRLSKYASEFKVPFKYNAIAVT 550
                       ***********************************************************999******************************* PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                       ++e+l+ e+L+++p+E+l+Vn+ +q ++l+desv +es+rd vL+ +++++P+ ++++  + + +++ F++rf e l yysalfd l+++ pr
  Bradi4g03867.1.p 551 NMESLRKEDLNIDPEEVLIVNCLFQFKNLMDESVVIESPRDIVLNNIRKMQPHAFIHAIVNGSFSAPFFVTRFREVLFYYSALFDVLDTTTPR 643
                       ********************************************************************************************* PP

              GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrer 318
                       ++e+r+ +E+ ++gr++ nv+acega+r+er et+++W+ +
  Bradi4g03867.1.p 644 DNEQRMLIEQNIFGRAALNVIACEGADRVERPETYKQWQVM 684
                       **************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.915342697IPR005202Transcription factor GRAS
PfamPF035148.0E-90368684IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 698 aa     Download sequence    Send to blast
MGSSPYLPSA MDSPGSDDPS LYLYLSDLVP GSPPSSLSAY LDLPPTPHHE QPQQQQQRSD  60
YDDLGSGGGG GGGGGGGDDK SSSTPEDLVL PFISRMLMEE DIDDKFFYDF PDNPALLQAQ  120
QPFLDILSDP SSNTTSSDSN NNNNPCSPSD ASFSPAGPLP PTPAAVDSYD SQPFQYDIDP  180
AAFFSAGANS DLMSSAFLKG MEEANKFLPS QGNLVIDLEA SSGQFLKGVE EGNKFLPKED  240
QLVVGFNGRA APVSAPTAVA SVKKEEPVDA VSANSHGGSR GRKNPYRDDE LERELGRSNK  300
QSALQGEDIS ARELFDRVLM PSPEMCVEQM QSLRIAMQEA VAKNDTGSGK VGNGKGRGRR  360
GGSDVVDLRT LLIHCAQAVA TDDRRSATEL LKQIKLHARH DGDGTQRLAH CFAEGLQARL  420
AGTGGLVHQS LMATRISAVD MLKAYQLYMA AICFKKVCFI FSNFTIYNAS LGKKKIHIID  480
YGIQYGFQWP CFLRRISERE GGPPEVRITG IDLPQPGFRP AGRIEETGRR LSKYASEFKV  540
PFKYNAIAVT NMESLRKEDL NIDPEEVLIV NCLFQFKNLM DESVVIESPR DIVLNNIRKM  600
QPHAFIHAIV NGSFSAPFFV TRFREVLFYY SALFDVLDTT TPRDNEQRML IEQNIFGRAA  660
LNVIACEGAD RVERPETYKQ WQVMRKMGSS RCGKSTR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-383726938322GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579265.10.0PREDICTED: scarecrow-like protein 34
TrEMBLA0A0Q3EEW90.0A0A0Q3EEW9_BRADI; Uncharacterized protein
STRINGBRADI4G03867.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-134GRAS family protein