PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g03160.1.p
Common NameBRADI_4g03160, LOC100822080
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 379aa    MW: 40371.8 Da    PI: 9.4868
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g03160.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.13.4e-32236291156
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                       k+r++W+peLH+rFv a+++LGG+++AtPk+i+e+mkv+gLt+++vkSHLQkYRl+
  Bradi4g03160.1.p 236 KARRCWSPELHRRFVAALQRLGGPQVATPKQIREMMKVDGLTNDEVKSHLQKYRLH 291
                       68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.865233293IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.5E-29233294IPR009057Homeodomain-like
SuperFamilySSF466892.99E-17233294IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-26236291IPR006447Myb domain, plants
PfamPF002491.3E-7238289IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MGPSSSSAAA ARKQQDQAAV LLGGGAAAAE EDNHQRRRMR AVAARAVTDS LRADEGKDKD  60
KAARLEECAR GLQAEKAKME VFRRELPISV TLIADVIEWL KDEVEQHRRP PVLMAPAPPS  120
SSPSPAAKRK QAEADASDKR SWMSSAQLWT CGSHSNGGIR KQQAQKLSNA FMPLGGGPPR  180
TTMAKSPERP EAAAMAVVPA DLSLSSPAAT ADAAPSSNSS AVTTDAGAQS AQQQRKARRC  240
WSPELHRRFV AALQRLGGPQ VATPKQIREM MKVDGLTNDE VKSHLQKYRL HTRRASSSDG  300
DHQHQQQSAA VWPPSEQPQY TASQHSTSKS GGSPMQLTGS SRATAGDSCD GEEEEEDGRS  360
ASYGWGMQLN GTMASSSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A7e-13236289154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-13236289154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-13236289154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-13236289154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi4g03160.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519512e-69JF951951.1 Triticum aestivum clone TaMYB68 MYB-related protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579224.10.0transcription factor HHO6
TrEMBLI1IH020.0I1IH02_BRADI; Uncharacterized protein
STRINGBRADI4G03160.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP55823353
Representative plantOGRP25631133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.13e-29G2-like family protein