PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g61024.1.p
Common NameBRADI_3g61024
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 582aa    MW: 66356.9 Da    PI: 7.7529
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g61024.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS322.67.8e-991995702373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       + lL++cAeav+s++ + a++lL+r++ ++s++g++ qRla+yf++AL+arla+++ + y+ l  ++ts    +e ++a++l+s ++ ++k++
  Bradi3g61024.1.p 199 EMLLIRCAEAVASNNRSSASELLERIKWHSSSRGNARQRLAHYFAQALEARLAGTGRQFYQPLIGTRTS---IVELIKAHHLYSATFCFVKVA 288
                       579*********************************************************999888887...9******************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                       +l  N++I++av+g +++Hi+ ++i+ GlQWp L++ La+R++gpp++R+T +++p++g   +e++ee g+rL ++A+++gv+++f++ ++ +
  Bradi3g61024.1.p 289 FLFSNKTIYNAVAGRRKLHIVHYGINTGLQWPDLIRWLANREGGPPEVRMTSIDRPQPGfrLSEQIEEAGHRLDNYASKFGVSIKFHA-ITAE 380
                       **********************************************************99999*************************.6889 PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                        e+++ e+L+++p+E+l+Vn+ +q  +l des++ +   +rd+vL+++k+++P  +v++ ++ +++s+ F++rf + l+ ++a++d +e+ +p
  Bradi3g61024.1.p 381 PEAVRAEDLHIDPDEVLVVNSLFQFRNLIDESLDFDRvsPRDKVLNTIKKMKPSAFVHAISNGSYGSTFFMTRFPHVLHNFTAMLDVMETMIP 473
                       9*******************************9988777****************************************************** PP

              GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                       r++++r  vEr++++r+++n++acega+r+e  +++++W+ r ++aG++++pl+ +++   k  +r+ + +  +++e++ +l++gWk+r+L++
  Bradi3g61024.1.p 474 RNNDKRLQVERAFFARSAMNMIACEGADRVEHPQNYKEWQTRSHRAGLRQLPLDPDIVLMLKEEVRNRYHKHLMINEHHWWLLQGWKGRALYA 566
                       *********************************************************************999********************* PP

              GRAS 370 vSaW 373
                       +S W
  Bradi3g61024.1.p 567 LSTW 570
                       **** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098553.144172551IPR005202Transcription factor GRAS
PfamPF035142.7E-96199570IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 582 aa     Download sequence    Send to blast
MLMEDGIVDK FVYQYPDQPK LLQAEQHFVQ ILSTAATASF DAQESSAPDA LACALLPSKV  60
QDPAFFWSGT VELSSTLFPL ECSTVMNKMS HMAFFKGIEE AKMFLPRDND MVDSRGCKNK  120
FDMGGVTEPA MGRSSKRIAV MVQTDTEDDE LKKMLDRLIL DGYDRYPGEM QDILITLDKE  180
NIRRHRRRGA RQMAVTDLEM LLIRCAEAVA SNNRSSASEL LERIKWHSSS RGNARQRLAH  240
YFAQALEARL AGTGRQFYQP LIGTRTSIVE LIKAHHLYSA TFCFVKVAFL FSNKTIYNAV  300
AGRRKLHIVH YGINTGLQWP DLIRWLANRE GGPPEVRMTS IDRPQPGFRL SEQIEEAGHR  360
LDNYASKFGV SIKFHAITAE PEAVRAEDLH IDPDEVLVVN SLFQFRNLID ESLDFDRVSP  420
RDKVLNTIKK MKPSAFVHAI SNGSYGSTFF MTRFPHVLHN FTAMLDVMET MIPRNNDKRL  480
QVERAFFARS AMNMIACEGA DRVEHPQNYK EWQTRSHRAG LRQLPLDPDI VLMLKEEVRN  540
RYHKHLMINE HHWWLLQGWK GRALYALSTW AADDAGGSEL T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-372025708374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003573186.10.0PREDICTED: scarecrow-like protein 33
TrEMBLA0A0Q3JUU10.0A0A0Q3JUU1_BRADI; Uncharacterized protein
STRINGBRADI4G09235.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-117GRAS family protein