PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g57267.1.p
Common NameBRADI_3g57267, LOC100845697
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRF
Protein Properties Length: 419aa    MW: 45596.3 Da    PI: 7.9785
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g57267.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.81e-2492135144
               WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                       d+epgrCrRtDGKkWRCs+++++++k+CE+H+hrg++rsrk++e
  Bradi3g57267.1.p  92 DPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHMHRGKNRSRKPVE 135
                       79***************************************998 PP

2QLQ62.79.9e-222055237
               QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                      +FTa+Q+q+L++Q+l+yKy+a+++P+P++Ll+++++
  Bradi3g57267.1.p 20 PFTATQWQELEHQALIYKYMASGVPIPSDLLLPLRR 55
                      9********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.6E-111955IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.2E-152053IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.4252055IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.57392136IPR014977WRC domain
PfamPF088792.3E-2093135IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MMMLGGRAAG AGGGGGGRCP FTATQWQELE HQALIYKYMA SGVPIPSDLL LPLRRSFLFD  60
PALATSPSLA FSPQSSLGWG CFGMGFGRKA EDPEPGRCRR TDGKKWRCSK EAYPDSKYCE  120
KHMHRGKNRS RKPVEMSLAT PPPSSSSSLS ASSSSTNASS AINAATTTTT SSSPAPSYHH  180
HHRHESSSPY THHALYGAGA GGPYGGRQQG YQVSGSPYHL HLDTTHPHPP PSYYSSAMDH  240
HKEHYAYGHT VLKEPPPTHG EHAFFSSSDH HAADRPGSDH GQWQFKQLGM EPPHKHNNNN  300
NTPILFYGNN GNNNGNGAAY AIDLCKEDDE EKERRQQQQH CFLLGADLRL DKPSSQHAAQ  360
AKPLRPFFDE WPHENKGGGG KPGSWMGLDG ETQLSISIPM ASANDLPITT TSRYHHGE*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g57267.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3538131e-153AK353813.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1002P02.
GenBankAK3564091e-153AK356409.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1034G13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570521.10.0growth-regulating factor 1
SwissprotQ6AWY81e-150GRF1_ORYSJ; Growth-regulating factor 1
TrEMBLI1IEL90.0I1IEL9_BRADI; Uncharacterized protein
STRINGBRADI3G57267.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Representative plantOGRP4601684
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.14e-51growth-regulating factor 5