PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g57000.2.p
Common NameBRADI_3g57000, LOC100842660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family CO-like
Protein Properties Length: 449aa    MW: 48210 Da    PI: 8.002
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g57000.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box27.56.6e-092364338
          zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                      +r C+ + + +++++C  ++ +lC++C ++ H+       H+
  Bradi3g57000.2.p 23 ARACDGCMRRRARWYCAADDAFLCQSCDTSVHSAnplarrHE 64
                      578*****************************6567777776 PP

2CCT67.24.6e-23395438144
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                       Rea+++RY+eKr+tR+F KkirYe+RK +Ae+RpR+KGrFvk++
  Bradi3g57000.2.p 395 REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRP 438
                       9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.8652168IPR000315B-box-type zinc finger
SMARTSM003362.5E-112168IPR000315B-box-type zinc finger
CDDcd000219.70E-112468No hitNo description
PfamPF006431.4E-72465IPR000315B-box-type zinc finger
PROSITE profilePS5101715.993395437IPR010402CCT domain
PfamPF062035.2E-18395437IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 449 aa     Download sequence    Send to blast
MSSSERKAGG GGGASAAVGG KAARACDGCM RRRARWYCAA DDAFLCQSCD TSVHSANPLA  60
RRHERLRLRG AMPMPMPVEG GVASETTMAT KTATKAKRLQ GGVAWAKRKA RTRRPPVKSV  120
GQLLLSRRLV VRVPDDHQAG AGGESSDEQR AAAAEDEEEQ QLLYRVPVFD PALGEFCSPP  180
PVEDYYAIGN DNDNAFVVGE DTNKQLVGPA SSSSPVQELP DCFASFGPTD AELREFAADM  240
EALLGGQDAL GGNEQLMAED SFYMEALGLV SPLSGDHKGV DAGRPVKVET DGGARRSSPP  300
TLVDDDDGSF EHKAATASYG EAADAGFLKR SLDLRLNYEA VIEGWGSSPW TDGRRPHGGQ  360
LDDLLLHDHY YSGMWTAAAG GGRAARPAAD DGGWREARVS RYREKRRTRL FAKKIRYEVR  420
KLNAEKRPRM KGRFVKRPAG AAPCAVVA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1405421RRTRLFAKKIRYEVRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126141e-49CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014756883.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16-like
TrEMBLI1IEI80.0I1IEI8_BRADI; Uncharacterized protein
STRINGBRADI3G57000.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32833058
Representative plantOGRP8021649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.15e-55B-box type zinc finger protein with CCT domain