PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g56490.1.p
Common NameBRADI_3g56490, LOC100830327
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family CO-like
Protein Properties Length: 394aa    MW: 43142.1 Da    PI: 5.0842
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g56490.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box20.87.8e-07435536
          zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg 36
                       C+ ++e++ +++C+++   lC +C  + H+ 
  Bradi3g56490.1.p  4 LCDFCGEQRPTIYCRSDAASLCLSCDRNVHSA 35
                      6***************************9954 PP

2zf-B_box26.99.9e-094790542
          zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg.......Htvvpl 42
                       C+++ ++++   C + ++ lC++C  ++H g       H+++p+
  Bradi3g56490.1.p 47 LCDRCASQPAAVRCLEENTSLCQNCDWNGH-GatslaagHKRQPI 90
                      7*****************************.66999999999886 PP

3CCT63.37.2e-22336379144
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                       R  al+RYkeK+k+RkF+KkirY+sRKa+A+ R+RvKGrFvk+ 
  Bradi3g56490.1.p 336 RGSALTRYKEKKKRRKFDKKIRYASRKARADVRKRVKGRFVKAG 379
                       6789*************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.3E-10147IPR000315B-box-type zinc finger
PROSITE profilePS501199.855147IPR000315B-box-type zinc finger
CDDcd000213.84E-6435No hitNo description
PROSITE profilePS501199.8974390IPR000315B-box-type zinc finger
PfamPF006431.1E-54790IPR000315B-box-type zinc finger
CDDcd000213.55E-64790No hitNo description
SMARTSM003360.0384890IPR000315B-box-type zinc finger
PfamPF062031.4E-16336378IPR010402CCT domain
PROSITE profilePS5101715.309336378IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MGALCDFCGE QRPTIYCRSD AASLCLSCDR NVHSANALSR RHMRTLLCDR CASQPAAVRC  60
LEENTSLCQN CDWNGHGATS LAAGHKRQPI NCYSGCPSSE ELSRIWSFAM DTHTAADEPN  120
CEEGISMMSI NDSGVNNHYA AEQESSLLDI ASTALMSHPP TVEKLKPLNS GDGMNLRPLA  180
THQPAGSVSV TPKVQCITDE NMFDDGSIYE DFCVDDADLT FENYEELFGT SHIQTEQLFD  240
DAGIDSYFET KEMPATESKE ELKPMQPECS NVVSADSSLC IPSRHAISSI SLSFSGLTGE  300
SNAGDHQDCG VSPMLLMGEP PWLPPGSEGS FASGSRGSAL TRYKEKKKRR KFDKKIRYAS  360
RKARADVRKR VKGRFVKAGE AYDYDPLSET RSY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1345349KKKRR
2345350KKKRRK
3346350KKRRK
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g56490.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570474.10.0zinc finger protein CONSTANS-LIKE 9
SwissprotQ9LUA91e-119COL10_ARATH; Zinc finger protein CONSTANS-LIKE 10
TrEMBLI1IEC40.0I1IEC4_BRADI; Uncharacterized protein
STRINGBRADI3G56490.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20793788
Representative plantOGRP13751334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48250.17e-96B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]