PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g56380.1.p
Common NameLOC100828498
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Dof
Protein Properties Length: 273aa    MW: 28120.1 Da    PI: 7.9051
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g56380.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.92.5e-3941101363
            zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                       ++ +kcprC+stntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk+k+sss
  Bradi3g56380.1.p  41 QEVVKCPRCESTNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKSKRSSS 101
                       6789*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-273393IPR003851Zinc finger, Dof-type
PfamPF027011.4E-334298IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4974498IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104682IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MEDFQSIPGL AGRLFGGAAA AADIRRAQGA ASSRCGGGFS QEVVKCPRCE STNTKFCYYN  60
NYNLSQPRHF CKSCRRYWTK GGVLRNVPVG GGCRKSKRSS SSATPASPTD ANNANSKTQR  120
RASSSSRDSN SNSGSTSPTA TPSSNTTPIT FANPFAGDVP PPAPIFADQA AALASLFAPP  180
PPPPLPVFNF SPQPKTEGSA ISSVAVLLAA AEPEAPTSVS ESAAAAADMA PFMSLDSTGI  240
FELGDDASAA SYWNAGSCCW GTDVQDPSVY LP*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that may transactivate seed storage protein genes in developing seeds. {ECO:0000250|UniProtKB:Q6K537}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g56380.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by gibberellin. {ECO:0000269|PubMed:11470159}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1008923e-92AK100892.1 Oryza sativa Japonica Group cDNA clone:J023130J11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570468.10.0dof zinc finger protein 4
SwissprotQ6Z3451e-84DOF4_ORYSJ; Dof zinc finger protein 4
TrEMBLA0A2K2D5C70.0A0A2K2D5C7_BRADI; Uncharacterized protein
STRINGBRADI3G56380.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64963050
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.13e-30DOF zinc finger protein 1
Publications ? help Back to Top
  1. Washio K
    Identification of Dof proteins with implication in the gibberellin-regulated expression of a peptidase gene following the germination of rice grains.
    Biochim. Biophys. Acta, 2001. 1520(1): p. 54-62
    [PMID:11470159]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]