PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g56080.1.p
Common NameBRADI_3g56080, LOC100846718
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 649aa    MW: 71158.6 Da    PI: 4.2523
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g56080.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.62.5e-49141501128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkya.........tgkrknratksgy 82 
                       l+pGfrFhPtdeelv++yL+++v g++l++ ++i+evd+y++ePwdLp  +++++++++wyfF++ d+k a          g+r+nrat +gy
  Bradi3g56080.1.p  14 LAPGFRFHPTDEELVSYYLRRRVLGRRLRI-DAIAEVDLYRLEPWDLPslSRIRSRDSQWYFFARLDRKVAgagaggrggPGNRTNRATPRGY 105
                       579***************************.99***************5448999999***********99877777665577********** PP

               NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       Wk+tgkd+ev++ +g++vg+kktLvf+ grapkg +t+Wvmheyrl
  Bradi3g56080.1.p 106 WKTTGKDREVFH-RGKAVGMKKTLVFHAGRAPKGDRTNWVMHEYRL 150
                       ************.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.55E-5611168IPR003441NAC domain
PROSITE profilePS5100555.80414168IPR003441NAC domain
PfamPF023655.5E-2716150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 649 aa     Download sequence    Send to blast
MSPSLPDHSP EVPLAPGFRF HPTDEELVSY YLRRRVLGRR LRIDAIAEVD LYRLEPWDLP  60
SLSRIRSRDS QWYFFARLDR KVAGAGAGGR GGPGNRTNRA TPRGYWKTTG KDREVFHRGK  120
AVGMKKTLVF HAGRAPKGDR TNWVMHEYRL LDNDGPQDLH VVCRIFQKLG TGPQNGAQYG  180
APYMEEEWEE EDDAIENAPA SGASTAMAAI TDTASPESNV EDENMYSKTN ELVQTQEVLN  240
PPETAPILAQ GLEETDEGSY GDGVISLEEI LQEPVSNVSV ENIGEPEEKT AIDDHFSLAD  300
LSGYPSQDDG YVALNGPIIC RDPSNGDHAY WPLRTYGHQN HANGTLNAEE FFDTGNDTNT  360
YSVEQQICPS DGQNLYLQTN GLPAPQQVDD NMAFYDASST HKWVDGKDDF ANANELLYQP  420
ENEPLFDVDD LMAYFDATED DFKFDMLGSV EGPNWPLPEN MLDFAPKDEN MDGFTFDGIS  480
KTSANVQYVA SSSGSHENLY LDTAVADIPM DDSADKSFGK RFASVLGSIP APPAMASEFP  540
PATGKSVASL SAVNGPSSIH VTAGIVQLGG LTFSGSSEHW PLQKNGDFSL LLSFTVESDV  600
STKSVGFDEP ATQLSTVPMV LRGGLYLFFV SAMILMFSYK VGSCIYSR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-4471508140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570443.10.0PREDICTED: NAC domain-containing protein 78
TrEMBLI1IE750.0I1IE75_BRADI; Uncharacterized protein
STRINGBRADI3G56080.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1462444
MonocotsOGMP129312833
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.11e-61NAC domain containing protein 2