PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g55120.1.p
Common NameBRADI_3g55120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 426aa    MW: 47656.8 Da    PI: 5.7173
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g55120.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like67.32.5e-21251296146
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehv 46 
                       k r+rWt+eLHe Fv a+ +LGGsekAtPk++ ++mkv+gLt++h 
  Bradi3g55120.1.p 251 KSRMRWTTELHELFVGAIIKLGGSEKATPKAVQKIMKVEGLTIYHF 296
                       68******************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.3E-8249295IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-17249295IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-14251295IPR006447Myb domain, plants
PfamPF143792.1E-17339385IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MYTAILDTST MSQFRDGEVP WYLSSDITVL PALPEVMVPS FPQYSASYIE RGLCRSSITP  60
LNTFLPASSG LQSTYMSASN FTSDLCINNG LPNEKLSSGS HIIAISGFDT SLSSTHSSYK  120
DDPSSLRMLY PKVSEEIYWV QEPVPGVFDY PASLNVSDQR NLVVSQEMQD IITLDHDTHL  180
AKQKEWFSSE SSGKFLENSG CGGSVLKAVD TRSTAPPNYT YFHMQNNVSS HFNVDELCSD  240
NFPSSDTAPT KSRMRWTTEL HELFVGAIIK LGGSEKATPK AVQKIMKVEG LTIYHFSFIR  300
FHLCTNLEGY LCLHNFKHIS KYPKGGVMPW VCARDLEDMD TSEGLRTQIG LQKQLHEQLE  360
IQRKLQLQVE EHSKYLEMAI AKQGESLKQL GALPVFENSR TQVLDHIKAC EDQTVDFSGR  420
EALRN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-17251303251Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-17251303251Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-17251303251Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-17251303251Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-17251303251Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-17251303251Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-17251303251Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-17251303251Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g55120.1.p
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235956.20.0protein PHOSPHATE STARVATION RESPONSE 2 isoform X1
TrEMBLA0A0Q3I6450.0A0A0Q3I645_BRADI; Uncharacterized protein
STRINGBRADI3G55120.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54942526
Representative plantOGRP1611433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.16e-32phosphate starvation response 1