PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g52880.1.p
Common NameBRADI_3g52880, LOC100825001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Dof
Protein Properties Length: 319aa    MW: 33780.2 Da    PI: 8.2367
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g52880.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1252.4e-3967126261
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                       +++ lkcprCds++tkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk++
  Bradi3g52880.1.p  67 HDSPLKCPRCDSAHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGSLRNVPVGGGCRKNKRA 126
                       67899*****************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-3065125IPR003851Zinc finger, Dof-type
PfamPF027014.1E-3369125IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.24571125IPR003851Zinc finger, Dof-type
PROSITE patternPS01361073109IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MMAGAAHPMH FCMDSDWLKG MVVPEDQGGA MGSSSPSSPS DTMIIACPQP MQQHQAQQQD  60
RRLRPQHDSP LKCPRCDSAH TKFCYYNNYS LSQPRYFCKT CRRYWTKGGS LRNVPVGGGC  120
RKNKRATRKP SSSSAVVVPV APSPAMPMSM MLHGGRHVET SGGLHLSFSG STMQLPSHTS  180
APDPLCSSLG LLDWKYDNVF SGSGGGTTFE SANSEAAHFT GQGMMGIGGS RGGADCHALD  240
ALRYAASLGM GEHLALPFGA GARAERDHAV EMKPLSLEWC GEASRVPESS TISSLSGLGL  300
WSGMISGAHH HHGSSAAI*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g52880.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU7308950.0EU730895.1 Brachypodium distachyon clone BAC DB009O11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570200.10.0dof zinc finger protein DOF5.6
TrEMBLI1ID220.0I1ID22_BRADI; Uncharacterized protein
STRINGBRADI3G52880.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.17e-38Dof family protein