PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g52500.2.p
Common NameBRADI_3g52500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 295aa    MW: 32605 Da    PI: 8.9469
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g52500.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.71.3e-332579155
           G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      kprlrWtp+LHerFveav++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYR+
  Bradi3g52500.2.p 25 KPRLRWTPDLHERFVEAVTKLGGPDKATPKSVLRLMGMKGLTLYHLKSHLQKYRM 79
                      79****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.7162282IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-322280IPR009057Homeodomain-like
SuperFamilySSF466891.56E-162581IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-242580IPR006447Myb domain, plants
PfamPF002499.3E-102778IPR001005SANT/Myb domain
PfamPF143799.6E-25124168IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MMFEGMERAG YGVGAGGVVL SRDPKPRLRW TPDLHERFVE AVTKLGGPDK ATPKSVLRLM  60
GMKGLTLYHL KSHLQKYRMG KQSKKDTGFE TSRAAFATHG ISFSSATPPV VPSAGNNNMG  120
ETPLADALRY QIEVQRKLHE QLEVQKKLQM RIEAQGKYLQ TILEKAQKNL TYDSSAATNL  180
EATRSQLTDF NLALSGFMDD ATQVCEQNNG ELAKVISEDN LRAGNLGFQL YHGVQDAEDV  240
KCTADEDLLL LDLNIKGGYD HRLSSHGMRR GDADLTVGQH RRWTGVKIWY GHGG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-212581157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-212581157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-212581157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-212581157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g52500.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570169.20.0myb family transcription factor PHL11
TrEMBLA0A0Q3IKK10.0A0A0Q3IKK1_BRADI; Uncharacterized protein
STRINGMLOC_14844.30.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39403470
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.19e-65G2-like family protein