PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g52320.3.p
Common NameBRADI_3g52320, LOC100834114
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 365aa    MW: 39163.9 Da    PI: 8.3197
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g52320.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.93.9e-32187240255
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Bradi3g52320.3.p 187 PRMRWTTSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 240
                       9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.3E-29184240IPR009057Homeodomain-like
SuperFamilySSF466892.33E-15185241IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-23187241IPR006447Myb domain, plants
PfamPF002491.9E-7188239IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MELFPSHPDL QLQLQISPPH PPTKPMDLGF WKRALDTTAN TTPATISTSS PPMARTTTTT  60
YPSAPSAGVG GFHPAASTAQ LGGGLQFLQH TQPILHEAQA DLASTMRPIR GIPVYNTVSP  120
SSFPSFLQSQ LHHHNLAHVQ HQHCYVDAII GAGGGAAGPR SPGKVSGVGI GVGAAALRPA  180
KRGSRAPRMR WTTSLHARFV HAVELLGGHE RATPKSVLEL MDVKDLTLAH VKSHLQMYRT  240
IKTTDHKTAA TSYGQAKTII EIADDSYFDI TNTSGSESSV QQSNLDGNEH GSNMCALWSN  300
NSSRGAWFQG KSRDANHGDI KSFEDVQPQS PDDDASDMNS PPFRLSELFL GAKKPNLDFT  360
LGRM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-16188242458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-16188242458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-16188242357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-16188242357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-16188242357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-16188242357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-16188242458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-16188242458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-16188242458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-16188242458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-16188242458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-16188242458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi3g52320.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235845.10.0probable transcription factor KAN2 isoform X2
TrEMBLA0A2K2D4S50.0A0A2K2D4S5_BRADI; Uncharacterized protein
STRINGBRADI3G52320.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17695.18e-43G2-like family protein